KEGG   Streptomyces malaysiensis: SMALA_7443Help
Entry
SMALA_7443        CDS       T05189                                 

Definition
(GenBank) xylulose kinase
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00040  Pentose and glucuronate interconversions
smal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMALA_7443
Enzymes [BR:smal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     SMALA_7443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ATL87660
UniProt: A0A291T3J2
LinkDB All DBs
Position
complement(9222274..9223731)
Genome map
AA seq 485 aa AA seqDB search
MAAAAVPVPQGPLVVGVDSSTQSTKALVVDSATGEVVARGQAPHTVGGGSDGTGKESVPE
QWWEALTEALRQCGTPAREAAAISVGGQQHGLVTLDAAGRSVRPALLWNDVRSAPQRDRL
IEELGGPKAWAERVGSVPAPAFTVTKWAWLMENEPEAARATAAVRLPHDYLTERLTGYGT
TDRGDASGTGWWASGTESYDEEILDRVGLSPELLPRVLRHGEAAGTVRELPDLPLPTGAL
VATGTGDNMAAALGLGLRPGQPVLSLGTSGTVYAVSAHRPTDPTGVVAGFADTRDAWLPL
ACTLNCTLAVDRIATLLGRDREAVEPGGSAVLLPFLDGERTPHLPHASGLLHGLRHDTTP
GQVLQAAYDGAVFALLTALDQVLDADAAPDAPLLLIGGGAKGTAWRETVRRLSGRPVRVP
RAEELVALGAAAQAAGLALGEDPAAVARRWSTAEGPSYGPVPRDEAALERLSQVLASADG
LLRHS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcagccgtacccgtgccacaaggaccactcgtcgtcggcgtggacagctcc
acgcaatcgaccaaggcgctcgtcgtcgactccgcgaccggcgaggtcgtcgcccgcggg
caggccccgcacaccgtcggcggcggcagcgacggcaccggtaaggagtccgtccccgag
cagtggtgggaggcgctgaccgaggcgctgcgccaatgcgggaccccggcccgggaggcg
gccgcgatctccgtgggcggccagcagcacggcctggtcaccctggacgccgcgggccgc
tcggtgcggcccgccctgctgtggaacgatgtgcgctccgcgccgcagcgcgaccggctc
atcgaggagctgggcggcccgaaggcatgggcggagcgggtgggcagcgtgcccgcgccc
gccttcaccgtcaccaaatgggcctggctcatggagaacgagccggaggcggcccgggcc
accgcggccgtccggctcccccacgactacctcaccgagcggctcaccggctacggcacc
accgaccgcggcgacgcctcgggcaccggctggtgggcctcgggcaccgagtcctacgac
gaggagatcctggaccgggtcgggctctcccccgagctgctgccgcgtgtgctgcgccac
ggcgaggccgccgggaccgtacgggagctgccggatctgccgctgcccaccggcgccctg
gtggccaccggcacgggcgacaacatggcggccgccctggggctcggcctgcgcccgggg
cagccggtgctcagcctgggcacctccggcaccgtctacgcggtctcggcccaccggccc
accgaccccaccggggtggtcgcggggttcgccgacacgcgcgacgcctggctgccgctg
gcgtgcaccctcaactgcacgctcgcggtcgaccggatcgcgacgctgctgggccgcgac
cgcgaggcggtggagccgggcggctcggccgtgctgctgccgttcctggacggcgagcgc
accccccatctgccgcacgcctcggggctgctgcacggtctgcgccacgacaccaccccg
gggcaggtgctccaggccgcctacgacggcgccgtcttcgccctgctcaccgcgctggac
caggtactggacgcggacgccgcgcccgacgccccgctgctgctcatcggcggcggcgcc
aagggcacggcgtggcgggagacggtccggcggctgagcggacgcccggtgcgggtgccc
cgggccgaggaactggtcgccctcggcgccgccgcgcaggccgcggggctggcgctgggc
gaggacccggcggcggtggcacggcgctggtcgaccgccgaagggccgtcctacggtccg
gtgccgcgcgacgaggcggcgctggagcggctctcccaggtgctggcgagcgcggacgga
ctgctccgccactcctga

DBGET integrated database retrieval system