KEGG   Streptomyces malaysiensis: SMALA_7453Help
Entry
SMALA_7453        CDS       T05189                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase-related, FMN-binding protein
Organism
smal  Streptomyces malaysiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx Pyridox_ox_2 Pyrid_ox_like DUF447
Motif
Other DBs
NCBI-ProteinID: ATL87670
UniProt: A0A291T3J9
LinkDB All DBs
Position
complement(9235721..9236149)
Genome map
AA seq 142 aa AA seqDB search
MAQNMTKDQWQKFLLEGTRTAKLSTVRADGSPHLAPVWFLLDGDDLVFNTGQETVKGRNL
ARDGRLAICVDDDRPPFAFVTLRGHAELIDDLEQIRHWATRIAARYMGEDRAEEFGARNG
VPGELLVRVHIDKVLALSGVAD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaacatgaccaaggatcagtggcagaagttcctcctggagggcacccgcacc
gcgaagctgtcgaccgtgcgggccgacggaagtcctcatctcgcccccgtgtggttcctg
ctcgacggtgacgacctcgtcttcaacacaggtcaggagacggtcaagggacgcaacctg
gcccgggacggccggctcgccatctgtgtggacgacgacaggccgccgttcgccttcgtc
acgctgcgggggcatgccgagctcatcgacgatctcgagcagatccgccactgggccacc
cggatcgccgcccgttacatgggcgaggaccgggccgaggagttcggcgcccgcaacggc
gtaccgggtgagctgctggtcagggtgcacatcgacaaggtgctcgcgctctccggagtc
gccgactag

DBGET integrated database retrieval system