KEGG   Streptomyces malaysiensis: SMALA_7467Help
Entry
SMALA_7467        CDS       T05189                                 

Definition
(GenBank) carbohydrate binding family 6
Organism
smal  Streptomyces malaysiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CarboxypepD_reg Glyoxalase_6
Motif
Other DBs
NCBI-ProteinID: ATL87684
UniProt: A0A291T3G6
LinkDB All DBs
Position
9251507..9252232
Genome map
AA seq 241 aa AA seqDB search
MSRFIPLERSTLYSPAWLIPYDDFARRVRAAGVSVQLDRYDDGEWLPLDDMAVRTPGAAF
AYPGLGRCAEPWAARPRRHRARFAADGYQPLYPADGRPFSAALVGVEFLVHPYDDAHPPT
VVTEPRLVRLLPSVSFRYPPGLRTVHGAVVDAATGAPIANALVEAGGHTSRDLTPWHERT
LSDPAGAFRLALRWEGEKADEHAVEETFHLQATERPGRSGSLVVRLPQDTERRHVIEIRE
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcttcataccgctggagcgatcgacgctctacagcccggcctggctcataccg
tacgacgacttcgcccggcgggtgcgcgccgccggggtgtcggtccagctggaccggtac
gacgacggcgaatggctgcccctggacgacatggcggtgcgcacccccggcgccgccttc
gcctatccgggtctcggccggtgcgccgagccgtgggcggcccggccgcggcgccaccgg
gcccgcttcgcggccgacggctaccagccgctgtacccggccgacggccggccgttctcg
gccgctctggtgggcgtcgaattcctggtccacccgtatgacgacgcccatccgccgacg
gtggtgaccgagccgcggctggtccggctgctgccgagcgtctccttccgctacccgccc
ggtctgcgcacggtgcacggcgccgtggtcgacgcggccaccggggcgccgatcgccaac
gcgctggtcgaggccggcgggcacaccagccgggacctgacgccatggcacgagcgcacc
ctgtccgaccccgcgggcgccttccggctggccctgcggtgggagggcgagaaggccgat
gagcacgccgtcgaggagacgttccacctccaggccaccgagcggccgggccggtccgga
tcgctggtcgtgcggctgccccaggacaccgagcgccggcacgtcatagagatccgcgag
agttaa

DBGET integrated database retrieval system