KEGG   Streptomyces malaysiensis: SMALA_7871Help
Entry
SMALA_7871        CDS       T05189                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K18009  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_7871
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     SMALA_7871
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     SMALA_7871
    1.1.1.-  
     SMALA_7871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP F420_oxidored NAD_binding_10 Epimerase 3HCDH_N ADH_zinc_N DFP
Motif
Other DBs
NCBI-ProteinID: ATL88081
UniProt: A0A291T4Z4
LinkDB All DBs
Position
9895423..9896166
Genome map
AA seq 247 aa AA seqDB search
MVVTGASSGIGVGIARRFAQEGANVVLAARRKDRLDALAAELGTERTLAVATDVTSQDAV
QAMIGAAVDRFGGLDVLVSNAGLGLGKDFEEMTLDDWRLVMRTDVDSCFFGARSALPHLK
RTRGSIVQIASASGLGGDRMLSAYNAAKGAVVNFTRGLAHDLGRFGIRVNAVAPSLTIGE
EHAVDHPDAGKLIERFNQRRALPGYSTPADIAGSVAFLASDDARFITGAILPVDGGITAG
SGQPPLF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtcaccggcgccagctccgggatcggggtcggcatcgccaggcggttcgcccaa
gagggagcgaacgtggtcctcgcggcacggcgcaaggaccggctggacgcgctcgcggcc
gaactcgggacggaacggacgctcgccgtggccaccgatgtcaccagccaggatgcggtc
caggcgatgatcggcgccgcggtggaccgattcgggggcctggatgtgctggtgtccaac
gccggtctgggcctgggcaaggatttcgaggagatgaccctcgacgactggcggctcgtc
atgaggaccgatgtcgacagctgcttcttcggggcgcggtcggcgctgccgcacctgaag
cggacccggggcagcatcgtgcagatcgcctcggcgtccggattgggaggcgaccggatg
ctctccgcctacaacgcggccaagggcgccgtcgtgaacttcacccgcgggcttgcccac
gacctcggccggttcggcatccgtgtgaacgccgtagccccctccttgaccatcggggag
gaacacgccgtcgaccaccccgacgccgggaagctgatcgagcggttcaaccagcggcgg
gcactgcccgggtacagcaccccggccgacatcgccggctcggtcgccttcctcgcctcc
gacgacgcccgcttcatcaccggggcgattctgccggtcgacggcggcatcaccgccggc
agcggccagcctcccctgttctga

DBGET integrated database retrieval system