KEGG   Serratia marcescens SM39: SM39_1506Help
Entry
SM39_1506         CDS       T03592                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase, specific for NADP+
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
smar  Serratia marcescens SM39
Pathway
smar00020  Citrate cycle (TCA cycle)
smar00480  Glutathione metabolism
smar01100  Metabolic pathways
smar01110  Biosynthesis of secondary metabolites
smar01120  Microbial metabolism in diverse environments
smar01130  Biosynthesis of antibiotics
smar01200  Carbon metabolism
smar01210  2-Oxocarboxylic acid metabolism
smar01230  Biosynthesis of amino acids
Module
smar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smar_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:smar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SM39_1506 (icdA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SM39_1506 (icdA)
Enzymes [BR:smar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SM39_1506 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: BAO33548
LinkDB All DBs
Position
1534232..1535485
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMIHVVDAAVKKAYHG
ERKISWMEIYTGEKSTHVYGKDVWLPDETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKAGSAEADKVIKFL
RDEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEG
AFKDWGYELAREEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGSDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIVEHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaaaaaaatcacggttgacgcccagggt
aaactggttgttcctcataacccgatcatcccgttcatcgaaggcgacggcatcggcgtt
gacgtgactcctgccatgatccacgtggttgatgcggccgttaaaaaggcttaccacggc
gaacgtaaaatctcctggatggaaatctacaccggcgaaaaatctacccacgtttacggt
aaagacgtgtggctgccggacgaaactctggacctgatccgcgactaccgcgtcgccatc
aaaggccccctgaccaccccggtcggcggcggcatccgttctctgaacgtggctctgcgc
cagcaactggacctgtacgtgtgcctgcgcccggtgcgttactaccagggcaccccaagc
ccggtgaaacagcctgagctgaccgacatggtgatcttccgtgaaaacgccgaagacatc
tacgccggcatcgagtggaaagccggctccgccgaagcggacaaagtgatcaaattcctg
cgcgacgaaatgggcgtgaagaaaatccgcttcccagagcagtgcggtatcggcgtgaag
ccatgctccgaagaagggaccaagcgtctggtgcgtgcggcgatcgaatacgccatcacc
aacgaccgcgactccgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggt
gccttcaaggattggggctatgagctggcgcgcgaagagttcggcggtgagctgatcgac
ggcggcccatggctgaagatcaagaacccgaacaccggcaaagagatcgtggttaaagac
gtgatcgccgacgccttcctgcagcaaatcctgctgcgcccggcggaatacgacgtgatc
gcctgtatgaacctgaacggtgactacatctccgacgccctggctgcccaggtcggcggc
atcggcatcgcaccgggcgccaacatcggctccgactgcgcgctgttcgaagcgactcac
ggcaccgcgccgaagtacgccggccaggacaaagtgaacccaggctccatcatcctgtcc
gcagagatgatgctgcgccacatgggctggttcgaagcggctgacctgatcgttaaaggc
atggaaggtgctatcgctgccaagaccgtgacctatgacttcgaacgcctgatggaaggc
gctaaactgctgaaatgttcagagtttggtgacgctatcgtagagcacatgtaa

DBGET integrated database retrieval system