KEGG   Serratia marcescens SM39: SM39_1674Help
Entry
SM39_1674         CDS       T03592                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu, Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smar  Serratia marcescens SM39
Brite
Enzymes [BR:smar01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SM39_1674 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: BAO33707
LinkDB All DBs
Position
1700555..1701076
Genome map
AA seq 173 aa AA seqDB search
MKRYWYAALGLMACGAAQAATTDVEMHLVTGQGIGQDIGKVAISETPYGLLFTPSLKALP
AGVHGFHVHEKGSCEPGMKDGKAVAALAAGGHFDPQKTGKHLGPYADGHLGDLPAIYVTA
DGMANYPVLAPRLKKISDIEGKALMVHAGGDNHSDHPQPLGGGGERFACGVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttattggtatgcagcgctcggcctgatggcgtgtggtgcggctcaggcggcg
acaaccgacgtcgagatgcacctggtgaccgggcaggggatcggtcaggacatcggcaag
gtggccatcagcgaaacgccgtatggcctgctgttcacgccgagcctgaaagcattgccg
gccggggtacacggcttccacgtgcatgagaaaggcagctgcgagccgggcatgaaggac
ggcaaagcggtggcggcgctggcggccggcggacatttcgacccgcaaaagaccggaaaa
cacctcgggccgtatgccgacgggcacctgggtgaccttccggcgatctatgtgaccgcc
gacggcatggcgaactatccggtgttggcgccgcggctgaaaaaaatcagcgacattgag
ggtaaagcgctgatggtgcacgccggcggcgacaaccattcggatcatccacaaccgctc
ggcggcggcggagaacgcttcgcctgcggtgtgatcaagtga

DBGET integrated database retrieval system