KEGG   Serratia marcescens SM39: SM39_2069Help
Entry
SM39_2069         CDS       T03592                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase, penicillin-binding protein 6b
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
smar  Serratia marcescens SM39
Pathway
smar00550  Peptidoglycan biosynthesis
smar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SM39_2069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:smar01002]
    SM39_2069
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smar01011]
    SM39_2069
Enzymes [BR:smar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SM39_2069
Peptidases [BR:smar01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SM39_2069
Peptidoglycan biosynthesis and degradation proteins [BR:smar01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SM39_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BAO34090
LinkDB All DBs
Position
complement(2125833..2127002)
Genome map
AA seq 389 aa AA seqDB search
MKRSVSVVIGGILLPLAAQAAGTTPHFPTMTPPAIDAASYVLMDYTTGQVLAAGNADERR
NPASLTKLMTGLVIDHALDQHKIGLDDVVTVGKDAWAQGNPVFKGSSLMFLKPGDRVTVR
DLSRGIIIDSGNDACVAMADYVAGSQANFVKLMNEKSAQLGLQNTHFETVHGLDAPGQFT
TAGDLAVIARAIIMSEPAEYHMYSEKSLTWNGITQQNRNGLLWDKTLHVDGLKTGHTASA
GFNIIASATEGDRRLIAVVMGGKSAKGREEQARKLLTWGLRDFTTVHLFSAGQSLGEEPV
WYGEDHRLPVGSAQNQSLSLPKNEADKLKAQYVINTARLEAPIGKAQTVGEIRISDNGQV
VKTLPLVALQAVPQGGVFSRLADYVKLKL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgttcagtatcagtggtgatcggcggtatattactgcctttagcggcgcaggcg
gcgggaacgacgccccattttcccaccatgaccccgccggcgatagacgccgcctcttac
gttttgatggattacaccaccggccaggtgttggctgccggcaatgccgatgaacggcgc
aacccggccagcctgactaaactcatgaccgggttggtgatcgaccacgcgcttgaccag
cacaagattggtcttgacgatgttgtcaccgtggggaaagacgcatgggcgcagggcaac
ccggtgttcaaggggtcttcgttgatgttcctgaagcccggtgacagggtcacggtacgc
gatctcagccgcggcattatcatcgattccggcaacgacgcctgcgtggcgatggcggac
tatgtggcgggcagccaggccaacttcgtcaagctgatgaacgagaagagcgcgcagctg
ggcctgcagaacacccatttcgaaacggtacacgggctggatgcgccggggcagttcacc
accgccggcgatctggcggtgattgcgcgtgccattatcatgagtgaaccggcggaatat
catatgtacagcgagaagtcgctgacctggaacggtatcacgcagcagaaccgcaatggg
ctgctgtgggataagacgctgcacgtcgatgggctgaaaaccgggcacaccgcctcggcc
ggcttcaacatcatcgcctccgccaccgaaggggatcgccgcctgatcgccgtggtgatg
ggcggcaaaagcgctaaggggcgtgaggagcaggcgcgtaagctgttgacctgggggctg
cgcgactttaccaccgtacacctgttcagcgccgggcagagcctgggggaagagccggtc
tggtacggcgaggatcaccgcttgccggtcggcagcgcgcagaaccagtcgctcagcctg
ccaaaaaacgaagcggacaagctgaaggcgcagtacgtaatcaataccgcacggctggaa
gcgccgattggcaaagcgcagaccgtcggcgagatccgcatcagcgacaatggccaggtg
gtgaaaaccctgccgctggtcgcgctgcaggcggtgccgcagggcggcgtgttctcgcgc
ctagcggattacgtgaagctgaagctctga

DBGET integrated database retrieval system