KEGG   Serratia marcescens SM39: SM39_2764Help
Entry
SM39_2764         CDS       T03592                                 

Definition
(GenBank) putative zinc-binding alcohol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
smar  Serratia marcescens SM39
Brite
KEGG Orthology (KO) [BR:smar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SM39_2764
Enzymes [BR:smar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SM39_2764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: BAO34753
LinkDB All DBs
Position
complement(2820380..2821447)
Genome map
AA seq 355 aa AA seqDB search
MSQLPEKMRAVVCHGPQDYRFEQVPTPLPKARELVIKVEGCGICAGDCKCKNGAQMFWGE
NPWVKPPVVPGHEFYGRIAALGEGAEGKYQLGERVIAEQIVPCWECRYCKSGSYWMCETH
NIYGFQKDVAEGGMAEYMRFSENAIVHKIPESLSHEDAVLIEPMACAIHTVARGDIQLDD
VVVLAGAGPLGLCMVQVARLKTPKKLIVIDAIDERLALAKAFGADVVINPLKEDADQIVK
SLTGGYGCDVYIEATGAPIGVTQGLQMIRKLGRFVEFSVFGKETTVDWSIIGDRKELDIR
GAHLAPYSYEIAIDLFERGLVTSNGVVTHSYSLNDWDEAFALADSTDSIKVILVP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttgccggaaaaaatgcgtgcggtcgtttgccacggcccgcaggactatcgt
ttcgaacaggtgcccacgccgttgccgaaggcgcgcgagctggtgatcaaggtggaaggc
tgcggcatctgcgccggcgactgcaagtgcaagaacggcgcgcagatgttttggggggaa
aacccgtgggtcaaaccgccggtggtgccggggcacgagttctacggccgcatcgccgcg
ctgggcgagggcgcggaaggcaaataccagctcggcgagcgggtgatcgccgagcagatc
gtgccgtgctgggagtgccgctactgcaaatccggcagttactggatgtgtgagacgcat
aacatttacggtttccaaaaagacgtggcggagggcggcatggcggagtacatgcgcttt
tccgagaacgccatcgtgcacaagatcccggaaagcctgagccatgaagacgcggtattg
attgaaccgatggcctgcgccatccacaccgtggcgcgcggcgacatccagctggacgac
gtggtggtgctggccggcgccgggccgctcgggctgtgtatggtgcaggtggcgcgcctg
aagacgccgaagaaactgatcgtgatcgacgccatcgacgagcggctggcgctggcgaag
gcgttcggcgccgacgtggtgatcaacccgctgaaggaagacgccgaccagatcgtcaaa
tcgctgaccggcggctacggctgcgacgtgtacatcgaggccaccggcgcgccgatcggc
gtcacccaggggctgcagatgatccgcaagctgggccgcttcgtggagttcagcgtgttc
ggcaaggaaaccaccgtcgattggtcgatcatcggcgatcgcaaagagctggacattcgc
ggcgcgcacctggcgccctacagctacgaaatcgccatcgatctgttcgagcgcgggctg
gtgacctccaatggcgtggttacccacagctattcattgaacgactgggacgaagccttc
gccctggcggactcgaccgactccatcaaggtgatcctggttccctga

DBGET integrated database retrieval system