KEGG   Serratia marcescens SM39: SM39_3084Help
Entry
SM39_3084         CDS       T03592                                 

Gene name
maeB
Definition
(GenBank) fused malic enzyme predicted oxidoreductase/predicted phosphotransacetylase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
smar  Serratia marcescens SM39
Pathway
smar00620  Pyruvate metabolism
smar01100  Metabolic pathways
smar01120  Microbial metabolism in diverse environments
smar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SM39_3084 (maeB)
Enzymes [BR:smar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     SM39_3084 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog Amidase_2
Motif
Other DBs
NCBI-ProteinID: BAO35057
LinkDB All DBs
Position
complement(3165764..3168043)
Genome map
AA seq 759 aa AA seqDB search
MDEQLKQSALDFHQFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIAEDPLAAYKY
TARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFSGIDVFDIEVDEHNPDKLI
DIIAALEPTFGGINLEDIKAPECFYIEQKLRERMKIPVFHDDQHGTAIITTAAVLNGLRV
VKKNISDVRLVVSGAGAASIACLNLLVALGLRQQNITVCDSKGVIYKGRDANMEQTKAAY
AIEDNGQRTLGDAIPNADIFLGCSGPGVLTQDMVKTMARDPLIMALANPEPEILPPLAKA
VRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATTINEEMKLACVHAIADLALAEQS
DVVASAYDDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMDSGVATRPIEDFDAYVEKL
AEFVYKTNLFMKPIFSQARKEVKRVVLAEGEEERVLHATQELVSQGLAFPILVGRPSVIE
MRLKKLGLQLTPGKDFEVVNNESDPRFNEYWGEYYQIMKRRGVSQEQARRAVIGNPTLIA
AIMLHRGEADAMICGTIGSYHEHYDVVKNVFGFREGAHVAGAMNALLLPSGNTFIADTYV
NDDPTPEQLAEITLMAAETVRRFGIEPKVALLSHSSFGSSDCPAARKMRKTLELVNELAP
ELEIDGEMHGDAALVESIRHDLMPDSPLKGSANLLIMPNMEAARISYNLLRVSCSEGVTV
GPVLMGVAKPVHILTPIASVRRIVNMVALAVVEAQTQPL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacagctcaaacagagtgcccttgatttccatcagtttcctgtcccagggaag
atccaggtttcccccaccaaaccgttggcgacccagcgcgatctggcgttggcctattcg
ccgggcgtcgccgcgccttgcctcgagatcgccgaagatccgctggcggcctacaaatac
accgcgcgcggcaacctggtggcggtgatttccaacggcacggcggtactgggtctgggc
aatatcggcgcgttggccggtaagccggtgatggaaggcaagggcgttttgttcaagaag
ttttccggtatcgatgtgtttgatatcgaagtggatgagcataaccctgacaaattgatc
gacattatcgccgcgctggaaccgaccttcggcggcatcaacctggaagacatcaaggcg
ccggagtgtttctacatcgaacagaaactgcgcgagcgcatgaagatcccggtgttccac
gacgaccagcacggcacggcgatcattaccactgcggcggtgctcaacggcctgcgcgtg
gtgaagaagaatatctccgacgtacgcctggtggtgtccggcgccggcgcggcctccatc
gcctgcctgaacctgctggtggcgctggggctgcggcaacagaacatcaccgtttgcgac
tccaagggcgtcatctataaaggccgcgacgccaatatggagcagaccaaagccgcctac
gccatcgaggataacggccagcgcacgctgggcgacgccatcccgaacgccgacatcttc
ctcggctgctccggcccgggcgtcttgacgcaggatatggtgaaaaccatggcgcgcgat
ccgctgatcatggcgctggctaacccggaaccggaaattctgccgccgctggccaaagcg
gtgcgcccggacgccatcatctgtaccggccgttccgattacccgaaccaggtgaacaac
gtcctgtgtttcccgttcatcttccgcggcgcgctggacgtgggcgcgaccaccatcaac
gaagagatgaagctggcctgcgtgcacgccatcgccgatctggcgctggcggagcagagc
gacgtggtggcttccgcctatgacgatcaggatctctccttcgggccggaatacatcatc
ccgaaaccgttcgatccgcgcctgatcgtcaagatcgcgccggcggtagccaaggcggcg
atggactccggcgtggcgacgcgcccgatcgaagacttcgacgcttacgtcgagaagctg
gcggagttcgtctacaaaaccaacctgttcatgaagccgatcttctcgcaggcgcgcaaa
gaggtgaagcgggtggtgctggcggaaggcgaggaagagcgcgtgctgcacgccacgcag
gagctggtgtcgcaggggctggccttcccgatcctggtcggccgcccgagcgtgatcgag
atgcgcctgaaaaagctgggcctgcagctgacgccgggcaaagatttcgaagtggtgaac
aacgagtcggatccgcgctttaacgaatactggggcgagtactaccagatcatgaagcgt
cgcggcgtctcgcaagagcaggcgcgccgtgcggtgatcggcaacccgacgctgatcgcc
gccatcatgctgcaccgcggcgaagcggacgcgatgatctgcggcaccatcggcagctac
cacgagcattacgacgtggtgaagaacgtgttcggcttccgtgaaggcgcgcacgtcgcc
ggcgcgatgaacgcgctgctgctgccgagcggcaacacctttatcgccgacacctacgtc
aacgacgatccgaccccggaacagctggcggagatcaccctgatggcggcggaaaccgtg
cgccgcttcggcatcgagccgaaggtggcgctgctgtctcactccagcttcggctcttcc
gactgcccggcggcgcgcaagatgcgcaaaacgctggagctggtgaacgagctggcgccc
gagctggagatcgacggcgaaatgcacggcgacgccgcattggtggaaagcatccgtcac
gatctgatgccggacagcccgctgaaaggctcggccaacctgctgatcatgccgaacatg
gaagcggcgcgcatcagctacaacctgctgcgcgtctcctgctcggaaggggtgaccgtc
gggccggtgctgatgggggtcgccaagccggtgcacatcctgacgccgatcgcctcggtg
cgccgcatcgtcaacatggtggcgctggcggtggtggaagcccagacccagccgctgtaa

DBGET integrated database retrieval system