KEGG   Serratia marcescens SM39: SM39_3763Help
Entry
SM39_3763         CDS       T03592                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smar  Serratia marcescens SM39
Pathway
smar00250  Alanine, aspartate and glutamate metabolism
smar00410  beta-Alanine metabolism
smar00640  Propanoate metabolism
smar00650  Butanoate metabolism
smar01100  Metabolic pathways
smar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SM39_3763 (puuE)
   00650 Butanoate metabolism
    SM39_3763 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SM39_3763 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SM39_3763 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smar01007]
    SM39_3763 (puuE)
Enzymes [BR:smar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SM39_3763 (puuE)
Amino acid related enzymes [BR:smar01007]
 Aminotransferase (transaminase)
  Class III
   SM39_3763 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAO35705
LinkDB All DBs
Position
complement(3882668..3883933)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGVGVMCGFYAERAENATLWDVEGKEVIDFASGIAVLNTGHRHPK
VIAAIEKQLQAFTHTAYQIVPYESYVSLAERINQRAPIAGPCKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLDRLFKADIDPKQVAAIVLEPVQGEGGFNVAPADFMQALRALCDQHGILLIADEV
QTGFARTGKLFAMEHYSVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAQRLGQHLVEVLQQARKTSPAIADVRAQGSMVAVEFND
PATGKPSADITRQVQQKAMKEGLLLLSCGVNGNVIRFLYPLTIPDDQFTKAMGILSRALA
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaattgaaccaacgccgtcaggacgccaccccgcgcggagtgggcgtg
atgtgtggtttttacgccgagcgcgcagagaacgccacgctgtgggatgtggaaggcaaa
gaagtgatcgatttcgcctcggggatcgccgtgctgaacaccggccaccgccacccgaag
gtgatcgccgcgattgaaaagcagctgcaggccttcacccacaccgcctatcagatcgtt
ccttacgaaagctatgtctcgctggcggagcgcatcaaccagcgcgcgccgatcgccggc
ccgtgtaaaaccgccttcttcaccaccggcgcggaggcggtggaaaacgcggtgaagatc
gcccgcgcttacaccggccgcccgggcttgatcaccttcggcggcggcttccacggccgt
acctacatgaccatggcgctgaccggcaaagtggcgccttacaaactgggcttcgggccg
ttccccggttcggtgttccacggccagtacccgaatgcgctgtacggcgtgactaccgaa
gacgcgatgaacagcctggatcgcctgtttaaagcggatatcgatcccaagcaggtggcg
gcgatcgtgctggagccggtgcagggcgaaggcggtttcaacgtggcgccggccgacttt
atgcaggcgttgcgcgcgctgtgcgaccagcacggcattcttctcattgccgacgaagta
cagaccggcttcgcccgtaccggcaagctgttcgccatggagcactacagcgttaaaccg
gatctgatcaccatggcgaaaagcctggcgggcggcatgccactgtcggcggtggcgggc
cgcgccgaggtgatggacgcgccggcgccgggcgggctgggcggcacctatgccggcaac
ccgctggcggtggccgccgcgcacgcggtgctggacgtgatcgaagaagagcagctgtgc
cagcgcgcccagcgcttggggcagcacctggtggaagtgctgcagcaggcgcgcaaaacc
agcccggcaattgcggatgtgcgggcgcaaggttcgatggtggcggtggagttcaacgat
ccggccaccggtaaaccatcagccgatatcacccgtcaggttcagcagaaggcgatgaaa
gaagggctgctgctgctgagctgcggcgtgaacggcaacgtgatccgcttcctgtatccg
ctgaccatcccggacgatcagttcaccaaggcgatgggcatcctgtcccgcgcgctggct
cactaa

DBGET integrated database retrieval system