KEGG   Serratia marcescens SM39: SM39_4430Help
Entry
SM39_4430         CDS       T03592                                 

Gene name
malS
Definition
(GenBank) exported alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
smar  Serratia marcescens SM39
Pathway
smar00500  Starch and sucrose metabolism
smar01100  Metabolic pathways
smar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SM39_4430 (malS)
Enzymes [BR:smar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SM39_4430 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: BAO36353
LinkDB All DBs
Position
4620306..4622369
Genome map
AA seq 687 aa AA seqDB search
MKLLPLPLLMLLSPSALAGWTLPGFPAFDETAAGLFTSQAALPKGQLPLRLYQDNHCWQP
AEAVKLNQTLSLQPCGAHPPASWRQFRAGDYQVRIDTRSGTPTLQLSLRSAPESAAVVAR
SCPRWDGKPVTVDVASTFAEGETLRDFYSGQTAQVNQGKITLQPAAASGGLLLLESATTA
KPAAFSWHNATVYFVLTDRFENGNPANDHSYGRRSDGLQEIGTFHGGDLAGLTQKLDYLQ
QLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYALDWTRLDANMGTEQELRTLVEQ
AHRRGIRILFDVVVNHVGYATLADMQTFHFGSLYLQDAEVEKTLGKNWGDWRPGPGQNWH
SFNDYINFSDKAGWRQWWGKNWIRTDIGDYDSPGYDDLTMSLAFLPDIKTEAPGASGLPL
FYRHKPDTAARDIPGATTRDYLTVWLSQWVRDYGIDGFRVDTAKHVEKPTLALLKQRATA
ALAAWKADHPQQALDDAPFWMTGEAWGHGVMKSDYYQNGFDAMINFDFQDQAAQALGCFA
DIDATYRQMAERLQDFNVLSYLSSHDTRLFFASDAKGSLPLQQRAANLLLLAPGAVQIYY
GDESGRPLGPTGSDPLQGTRSDMNWRELLGAKAPMLAHWQRLGQFRARHPAIGGGVQTPQ
PHAAYYAFSRRLGDDKVMVVWAGERSQ
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttacccctgcccttgttgatgctgctgtcgccttcggcgctggccggctgg
acgctgccgggtttcccggccttcgacgaaactgccgccgggctgtttaccagccaggcc
gcgctgcccaaaggccagctgccgctgcgcctgtatcaggataaccactgttggcagccg
gccgaggcggtgaagcttaaccagacgctgtcgctgcagccctgcggcgcccatccgccg
gccagctggcgacagttccgcgccggcgactatcaggtgcgcatcgacacccgcagcggc
acgccgacgctgcagctcagcctgcgcagcgcgccggaaagcgccgccgttgttgcccgc
agctgcccgcgctgggacggcaagccggtcacggtcgacgtcgcctccaccttcgccgaa
ggcgaaacgctgcgcgatttctattccggccaaacggcgcaggtgaaccagggaaaaatc
acgctgcagcccgccgccgccagcggcggcctgttgctgctggagtccgccaccacggcg
aaaccggcggcgttcagctggcataacgccacggtctacttcgtgctgaccgatcgcttt
gagaacggcaatccggccaatgaccacagctacgggcgccgcagcgacggcctgcaggaa
ataggcacctttcacggcggcgatctggccggcctgacgcaaaaactggattatctgcag
cagctcggcgtcaacgccttgtggatcagctcgccgctggagcagatccacggctgggtc
ggcggcggcaccaaaggcgatttcccgcattacgcctatcacggctattacgcgctcgac
tggactcgcctcgacgccaacatgggcaccgaacaggagctgcgcacgctggtcgagcaa
gcgcatcggcgcggcattcgcattctgttcgacgtggtggtgaaccatgtcggttacgcc
acgctggcggatatgcagacgtttcacttcggctcactgtatctgcaagacgcggaggtg
gagaaaaccctggggaaaaactggggcgattggcgccccgggccagggcaaaactggcac
agtttcaacgactacatcaacttcagcgacaaggcgggctggcgccaatggtgggggaaa
aactggatccgcaccgacatcggcgactatgactcaccgggctatgacgatctgacgatg
tcgctggccttcctgccggacatcaaaaccgaagcgcccggcgccagcggcctgccgctg
ttctatcgccacaaacccgacaccgccgcgcgcgacattcccggcgccaccacccgcgat
tacctgaccgtctggctcagccagtgggtgcgcgattacggcatcgacggttttcgcgtc
gataccgccaagcacgtggaaaaaccgacgctggcgctgttgaagcagcgcgccacggcg
gcattggcggcgtggaaagcggatcatccgcagcaggcgctggatgacgcgccgttttgg
atgaccggcgaggcctggggccacggggtgatgaaaagcgactattaccaaaacggcttc
gacgcgatgatcaacttcgacttccaggaccaggcggcgcaggcattgggctgctttgcc
gacatcgacgccacctaccggcagatggccgagcggctgcaggatttcaacgtgctgagc
tacctctcttcacacgacacccggctgttcttcgccagcgacgccaaaggctcgctgccg
ctgcaacagcgggcggcgaacctgctgttgctggcgccgggcgcggtgcagatttactac
ggcgatgaaagcggccgcccgctcggccccaccggttccgatccgctgcagggcacccgc
tccgacatgaactggcgtgagctgctgggggcaaaagccccgatgctggcccactggcaa
cggttggggcagttccgcgctcgccatccggcgatcggcggcggcgtgcaaaccccgcag
ccacacgccgcctactacgccttcagccgccggctcggcgacgataaggtgatggtggtg
tgggccggcgaacggtcacaataa

DBGET integrated database retrieval system