KEGG   Shewanella marisflavi: CFF01_05910
Entry
CFF01_05910       CDS       T05400                                 

Definition
(GenBank) ATP-binding protein
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
smav  Shewanella marisflavi
Pathway
smav01503  Cationic antimicrobial peptide (CAMP) resistance
smav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFF01_05910
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CFF01_05910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smav01001]
    CFF01_05910
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:smav02022]
    CFF01_05910
   01504 Antimicrobial resistance genes [BR:smav01504]
    CFF01_05910
Enzymes [BR:smav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CFF01_05910
Protein kinases [BR:smav01001]
 Histidine kinases
  OmpR family
   CFF01_05910
Two-component system [BR:smav02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   CFF01_05910
Antimicrobial resistance genes [BR:smav01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    CFF01_05910
SSDB
Motif
Pfam: HATPase_c HATPase_c_5 HATPase_c_2 HATPase_c_3 HisKA CDT1_C SHE3
Other DBs
NCBI-ProteinID: ASJ96155
LinkDB
Position
complement(1325435..1326847)
AA seq 470 aa
MSSQRAPQGKLNSLRVRLIISALLLILLLLPTIGFTLNNAFKQQVLNNVNEQLSAYLYSV
LAVTEMEDGKLYMPEALLENQFNVIGSGLYAIIVRQNNNLTDSDRQGDGATDNAPLWSSN
SFLGLSLTAPLPHPKVGRSEFGNITVEGKPHLIYSFSVRFAPTEPQSLSAPITVHIIKDL
AGVEQQQQAFSQHLWTWLFILTAVLLATQFAWLAWTLKPLARFKEELGQVQRGEAQQLSG
HYPNELQDVAKQLNTLLSTEQRQRSRYRNALSDLAHSLKTPLAVIQSQKDLSATSQEQVS
QINRTIGHQLKRAQSAAGNAWHLGIKVNQVSDKLLRTLVKIHPDVQLNYGKVPDNQDIFY
GDQSDLTEMLGNLLDNACKAAQSRVELSVESRSGKLIISVEDDGQGISPAQRQTILERGK
RADTYAKGHGIGLAIVRDLVDSYQGSLSIDESKSLGGAKFELMFEQQFAS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgagcagtcagcgagccccacagggcaaacttaactccctcagggttcgcctgatcatc
agcgcgctgctattaatcctgctgctgttacccaccatcggctttactcttaataacgcc
tttaaacaacaggtgcttaataacgtcaatgagcagctgagcgcctacctctattcggta
ttagccgtgactgagatggaagacggcaaactctatatgccagaggcgctgctggaaaat
caatttaatgttatcggctctggcctttatgccattattgttcgtcagaacaataaccta
actgatagcgaccgtcagggcgacggcgcaactgacaatgcccccctttggtcatctaat
tcttttcttggccttagcctgacagcaccactgccacaccctaaggtgggacgcagcgaa
tttggcaatataacggtggaaggcaaaccccatctcatctacagctttagcgtgcgcttt
gccccgactgagccgcaatcattaagtgcccccattaccgtccacatcatcaaagacttg
gctggtgtcgagcagcaacaacaggcctttagtcaacacctctggacctggctgtttatc
ttgacggccgtcttgctggcgacgcaatttgcctggctggcctggacactaaaacccctg
gcccgctttaaagaggagcttggacaagtacagcgcggcgaggcgcagcagctcagcggt
cactaccccaacgaattgcaggatgtggccaaacagctcaacaccctactcagtaccgag
cagcgccagcgcagccgctatcgtaatgcactttctgatttggcccacagcctgaagacc
cccttagccgtgattcaaagtcaaaaagatctcagtgcgacctcacaggaacaggtgagt
cagattaaccgcaccataggccatcagctcaaacgggcgcagagcgcggctggtaacgcc
tggcatctggggattaaggtcaatcaagtctcagataaactgctgcgtacattggtcaag
atccaccctgatgtgcaactgaactatggcaaggtgcctgataaccaagatatcttttat
ggcgatcagagcgatctgaccgagatgttgggtaacctgctggataacgcttgtaaagcc
gcgcaatcacgagtcgaactcagtgttgaaagccgctcaggcaagctcattatcagcgtc
gaagatgatgggcaaggcattagcccggctcagcggcaaaccatcttagaacggggaaaa
cgcgccgacacctatgcaaagggccatggtatcgggttggccatagtgcgtgacttggtg
gacagctatcagggctcactatccatagatgagagtaagagcttaggtggcgccaagttt
gaactcatgtttgaacaacaatttgcgagttaa

DBGET integrated database retrieval system