KEGG   Shewanella marisflavi: CFF01_08590Help
Entry
CFF01_08590       CDS       T05400                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smav  Shewanella marisflavi
Pathway
smav00473  D-Alanine metabolism
smav00550  Peptidoglycan biosynthesis
smav01100  Metabolic pathways
smav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFF01_08590
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFF01_08590
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CFF01_08590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smav01011]
    CFF01_08590
Enzymes [BR:smav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CFF01_08590
Peptidoglycan biosynthesis and degradation proteins [BR:smav01011]
 Precursor biosynthesis
  Amino acid ligase
   CFF01_08590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ASJ96642
UniProt: A0A220PVR8
LinkDB All DBs
Position
complement(1971228..1972232)
Genome map
AA seq 334 aa AA seqDB search
MNPINLLLLCGGGGDEHAISLLSADYFETSLAKLSHLNVLRVELDDKGQYQTKSGQRCEL
TNRREIRFEDESQAPWPVDYVIPCIHGYPGETGDIQSYFELINLPYFGCDAEGSRNCFNK
ITAKMWFSALGIPNTPYLFLNQLDEQAIAQTTDALAKWGSVFIKAASQGSSVGCYRVDDA
EQIASTLADAFRYSPYVVVEKTIQARELEVAVYQYRGETVATLPGEVICAGGTFYTYEEK
YATDSKATTRVVAEVSDEIAQQIRAYAVKVFDGMKLRHLSRIDFFLTPEGEILLNEINTF
PGLTPISMFPKMLANHGDDFSEYLNEAISTGLGR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgattaatcttttgcttttatgtggcggtggcggcgacgaacacgcgatctca
ctgctatcggcagactacttcgagacctctctggcaaaactgtctcatcttaatgtgctg
cgcgtcgaactcgatgacaagggacaataccagaccaagtccggccagcgctgtgaactc
actaaccgccgtgagatccgctttgaagatgagagccaagccccctggcccgtcgactat
gtgatcccctgcattcatggttatcccggtgagacgggcgatattcaatcatacttcgag
ctgatcaatctgccctatttcggctgtgacgccgaaggatcacgcaactgcttcaacaag
atcaccgccaagatgtggtttagcgcgctggggatccctaacaccccttacctctttctg
aatcaactggatgagcaagcaattgcccaaaccactgatgccctggctaagtggggctct
gtctttattaaggcggcctcccaaggctcctctgtgggctgttatcgggtcgatgatgca
gagcaaattgccagcaccctggccgatgcctttcgttattcgccctatgtcgtggtcgaa
aaaaccattcaggcccgtgagctggaagtggccgtctatcaatatcgcggcgagaccgtt
gccacactgccaggcgaggtgatctgcgccggcggcaccttctatacctatgaagagaag
tacgccaccgacagcaaagccaccactcgggtagttgccgaggtaagtgatgagatagcc
cagcagatccgcgcctacgcggtgaaggtattcgatggtatgaagctcagacacctatca
cgtatcgacttcttcctcaccccagaaggcgagatattactcaatgagatcaacaccttc
ccaggcctaactcccatctccatgttccccaagatgttagccaatcacggtgatgatttt
agcgaatacttaaacgaggcgatttcgaccggactcggtcgataa

DBGET integrated database retrieval system