KEGG   Shewanella marisflavi: CFF01_09060Help
Entry
CFF01_09060       CDS       T05400                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
smav  Shewanella marisflavi
Brite
KEGG Orthology (KO) [BR:smav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:smav01002]
    CFF01_09060
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smav04147]
    CFF01_09060
   04090 CD molecules [BR:smav04090]
    CFF01_09060
Enzymes [BR:smav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CFF01_09060
Peptidases [BR:smav01002]
 Metallo Peptidases
  Family M2
   CFF01_09060
Exosome [BR:smav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFF01_09060
CD molecules [BR:smav04090]
 Proteins
  CFF01_09060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ASJ96718
UniProt: A0A220PW33
LinkDB All DBs
Position
complement(2076962..2078833)
Genome map
AA seq 623 aa AA seqDB search
MIPIRAQLTPLAMVIALTLGASGCESDANTKQTNPQQASTDNATNPVASIEDAKTFIAKA
ESELASLSIEQNRAEWIYSNFITEDTAALAASVGERQTALSVQLATQAANYTQLPLNDTD
KRKLNILRSALVLPAPLDPKKNAELANISAELNGLYGKGKYCLEDGRCLTQPELSGIMAS
SRNPQELEAIWQGWRAIAKPMRPLFEREVELANEGAKDLGYANLSELWRSQYDMQPDAFS
DELDRLWGQVSPLYESLHCYVRGELNEQYGDEVAPEQGPIPAHLLGNMWAQQWGNIYDLV
APENADPGYDVTELLAKQGYDEHKMVKQAEGFFTSLGFEPLPDTFWSRSLFVQPKDRDVV
CHASAWDLDNLDDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKDQPFIFKNSANDGFHE
AIGDTVALSITPNYLKQIGLLDEVPDASKDIGLLLKQALDKVAFLPFGLMIDQWRWKVFS
GEITPAQYNQAWWQLREKYQGVKAPVVRSEADFDPGAKYHVPGNVPYTRYFLAHILQFQF
HKALCDIAGDKGPVHRCSIYGNKEAGAKLNAMLEMGQSKPWPEALEVVTGKQEMDASAVL
DYFAPLKVWLDEQNKQANRQCGW
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgatccccattcgtgcacaattgaccccacttgccatggtcattgcgttaactctcggc
gcaagcggctgtgaaagtgatgctaatacgaaacaaactaacccacagcaagccagcaca
gataatgccaccaaccccgtggccagcatcgaagacgctaaaacatttatcgctaaagcc
gagtcagaactcgcctcgctctccattgaacaaaatcgcgccgagtggatctacagtaat
tttatcaccgaagacacggcagccctcgcggcctctgtgggtgagcgccaaaccgcgctg
tcggtacaactagccactcaagcggctaactacactcaactgccactcaatgataccgat
aaacgtaaactcaacatcttacgtagcgcgttagttttacccgcaccattagacccgaaa
aagaatgcggaactggcaaacatcagcgccgagctgaatggcctttacggtaagggcaaa
tattgcctggaagacggtcgctgcctaacgcaaccagagctctcaggcattatggccagt
tcacgcaatccccaagaactcgaggcgatatggcaagggtggcgagctatcgccaaacct
atgcgcccgctgtttgaacgtgaagttgaactggctaacgagggcgcaaaagatcttggc
tacgccaacctatctgaactttggcgcagccagtatgacatgcagccagatgccttctca
gacgaactcgaccgactctggggtcaggtatcaccattatatgaatccctgcactgctat
gtcagaggcgagctcaacgagcagtatggtgacgaagttgcgccggagcaaggtccaatc
cctgcccacctcttaggtaatatgtgggcccagcaatggggtaacatttatgatcttgtc
gcgcctgaaaatgccgatcctggttatgatgtcaccgagctgcttgctaagcagggttat
gatgaacataagatggttaaacaggctgaaggctttttcacatccttaggtttcgagccg
ctaccagacactttctggagccgttcactcttcgtacaacctaaagatcgtgatgttgtt
tgtcatgcctcggcgtgggatctggataacctggatgatatccgcattaagatgtgtatt
cagaaaaccgctgaagacttcaccgtgatccatcatgagctggggcataacttctaccaa
cgtgcttataaagaccaacctttcatctttaaaaacagcgctaacgacggcttccatgaa
gccattggtgacacggtcgcgctgtcgatcacaccaaattatctcaagcaaatcggcctg
ctcgatgaggtacccgatgcgtctaaagatattggtctattgctaaagcaggcactagac
aaggttgccttcttaccctttggcctgatgatcgaccaatggcgctggaaggtgttcagt
ggtgagatcaccccggctcaatataaccaggcctggtggcaattaagagaaaagtatcaa
ggtgtgaaagcgccagtggtgcgcagcgaagcggacttcgatcccggcgccaaataccat
gttcccggtaacgtaccttatactcgctacttcctggctcacatactacagttccagttc
cataaggcgctgtgtgatatcgcgggcgataaggggccagtgcatcgttgcagcatctat
gggaacaaggaagccggcgcgaaacttaatgccatgttagagatgggtcaaagtaagcct
tggccagaagcgcttgaagtggtcaccggcaaacaggagatggatgcctcggcggtgctg
gactactttgcgccactgaaagtttggctagatgagcagaataaacaggcgaatcgtcag
tgtggttggtaa

DBGET integrated database retrieval system