KEGG   Shewanella marisflavi: CFF01_09990Help
Entry
CFF01_09990       CDS       T05400                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
smav  Shewanella marisflavi
Pathway
smav00500  Starch and sucrose metabolism
smav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFF01_09990
Enzymes [BR:smav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CFF01_09990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ASJ96880
UniProt: A0A220PWF9
LinkDB All DBs
Position
2286235..2288730
Genome map
AA seq 831 aa AA seqDB search
MTSKPARFTRTLIALSLGTLLSACGGADQPAPKQVAAAASLNIAPGAPGAEPTWAFSGKT
GIGTSYEPYVTTEQSAGRYLDTQANPVSRVWFSLAQGVLTETMYGLIHNAQLKEAQFIIA
GNGFVDTEKENTITSIDYLHKDDAGRPLSLAYKVVNKDIEGKYQIEKHFFTDPDRDSLVM
KVFFTAFEPGITPYLYVNPHIDNSGANDIASVSADGNSLYAYTGNQDSSVLTVRADLPFS
QTSVGFVGVSDGLSDLKANGELNNLYSHTSADKQTLGNVAMTAALPTLKVGDAENPSLST
TFVFGFGQDQASSEQTAQKTLDAGYDAVLAAYNGEGDTIGWQDYLQQLSGLEAMTANTAD
AGKLLYASALVLKAQEDKTHAGALIASLSNPWGDTVSAVKGSTGYKAVWPRDFYQCAMAF
LAMGDTQTPKVAFEYLKKVQVSEATPGYEGVPGWFLQKTHVDGQIEWVGVQLDQTAMPIM
LGWKLWHAGVLSDQEISQWYQTMLKPAADFLVTGGEVNLDWNHTQIVPLKTQQERWEEQQ
GYSPSTAAAVIAGLISASDIAKQAQDLAAAERYLATAKEMAAKLDTLMVTQSPMLSASDG
TQAPYYLRLAPNGTPDKADKLADNNGRAGLDQRLILDGGFLEMVRYGVKPATDARINATL
KLIDNTKLEDNLRVRYEFTAKDGTRFPGFRRYGNDGYGEDTQTGGNYAENGSNTPGQRGR
VWPFFTGERAHFELAKAIATDSLDEAKKQQLIDTYVKGMEAFANKGLMLPEQVWDGVGDS
TRFNYQLGQGTNSATPLAWTHAEYVKMVRSLTDAKVWDHYPSVTDTLTSHP
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctaagcctgcacgttttactcgcaccttaatcgccctctccttaggcactctg
ctaagcgcctgcggcggtgcggatcagcctgcgccaaagcaagtggctgcggccgcaagc
ctcaacatagcaccaggtgcacctggcgccgagccaacctgggccttctcgggtaaaacc
ggcataggcacatcctatgaaccctatgtcaccacagagcaaagcgccgggcgctatcta
gacacccaggccaacccggtcagccgcgtctggttttctctggctcaaggcgtgctgacc
gaaaccatgtatggccttatccataacgcccagctaaaagaggcacaatttatcatcgca
ggtaatggctttgtcgataccgagaaagagaacaccatcaccagcatagattatctgcat
aaagatgacgcaggtcgtcccctgtcattagcctacaaggtggttaacaaagatatcgaa
ggcaagtatcagatagagaaacacttctttaccgatcccgatcgtgacagcttagtgatg
aaggtgttctttaccgcctttgagccgggcattaccccctatctttatgtaaacccgcat
atcgataatagcggcgccaatgatattgccagcgtgagcgccgatggcaatagtctctat
gcctataccggcaaccaggattccagcgtgttgaccgtgcgcgccgacctcccctttagc
cagaccagcgtcgggtttgtcggcgtatcggacggcctgagcgatctcaaggctaacggt
gagttaaacaacctttacagccacaccagtgccgacaaacagactttgggcaatgtcgcc
atgacagctgcgctgcctacgcttaaggtcggcgatgccgaaaatcccagcctgagcact
acctttgtattcggctttggtcaagatcaagccagcagcgagcaaactgcccagaaaact
cttgatgcgggctatgatgcggtgctggcggcctacaacggcgagggagataccattggc
tggcaggactatctgcagcaactctctgggcttgaggcgatgacagccaacaccgccgat
gcggggaaactcctgtatgccagcgcgcttgttcttaaggctcaggaagataaaacccat
gccggcgcccttatcgcctccttgtctaacccttggggcgacactgtctctgcggtcaaa
ggctcgaccggctacaaggccgtctggccaagagacttctatcaatgcgccatggctttc
ttagccatgggcgatacccaaacccctaaggtcgcctttgaataccttaaaaaagtgcag
gtcagcgaagcgactcctggctatgaaggcgttccaggctggtttttgcaaaagactcat
gtcgacggtcaaatcgaatgggttggcgtacagttagatcaaaccgcgatgcctatcatg
ctgggatggaaactctggcacgctggagtattaagcgatcaagaaattagccagtggtat
caaaccatgcttaagcctgcggccgattttctggtaacgggcggtgaagtaaaccttgac
tggaaccatacccagatagtcccgctaaagacacaacaggaacgctgggaagagcagcaa
ggctactcgccttcgacagccgctgccgtgattgcaggtctgattagcgccagcgatatc
gccaaacaggcgcaagatctcgccgctgccgagcgctacctggccaccgctaaagagatg
gccgccaagctggacacccttatggtgacccaaagccccatgcttagtgcaagtgacggt
acccaggcaccttactatctgcgcctagcgcctaatggcacaccggataaggccgataag
cttgccgataacaacggcagagccggactggatcagcgtctcatattagatggtggtttc
ctggagatggtgcgctatggggttaaaccggcgaccgatgccaggatcaatgccaccctt
aagcttatcgacaatacaaagctcgaagataacctcagggtgcgctacgagtttaccgcc
aaagatggtactcgcttcccaggatttcgccgctatggcaatgacggctatggtgaagat
acgcaaaccggcggtaactacgccgaaaatggcagcaatacgcctgggcaacggggccgg
gtatggcctttctttaccggcgagcgcgcccattttgaactggctaaggccattgcaaca
gacagcctggatgaggctaagaaacagcaacttatagacacctatgtaaaagggatggaa
gcttttgccaacaaaggcctgatgctccctgagcaggtttgggatggcgttggcgacagt
acccgctttaactatcagcttggccaaggtactaactcagccacgccgctagcctggact
cacgccgaatacgtcaagatggtgcgttccttaaccgatgcaaaagtctgggaccactat
ccaagcgtgaccgatacccttacctctcacccttaa

DBGET integrated database retrieval system