KEGG   Shewanella marisflavi: CFF01_10190Help
Entry
CFF01_10190       CDS       T05400                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smav  Shewanella marisflavi
Brite
Enzymes [BR:smav01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CFF01_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASJ96920
UniProt: A0A220PWJ6
LinkDB All DBs
Position
2328127..2328711
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLVEGTELAEKSLEEIIKTS
TGGIFNNAAQIWNHTFYWNCLSPNGGGAATGDIAAAIDAAFGSFDAFKAQFTDAAVNNFG
SAWTWLVKKADGSVAIVNTSNAATPLTEEGVTPLLTVDVWEHAYYIDYRNVRPDYMAAFW
NLVNWDFVNSNFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattaccagcactgccttatgcgaagaacgcactcgagccccatatttcc
caagaaaccatcgagtaccactatggtaagcatcacaacacctatgtagtgaaactaaat
ggtcttgttgaaggcactgaacttgccgagaagagcctagaagagatcatcaagacttct
actggcggcatcttcaacaatgcagctcaaatctggaaccacactttctactggaactgt
ctgtcacctaatggcggcggcgcagccactggcgatatcgctgctgcaatcgatgccgct
ttcggttcattcgatgcattcaaggctcagttcactgacgcagctgttaataacttcggt
agcgcttggacttggttagttaagaaggctgacggtagcgttgcaatcgtgaacaccagc
aatgctgcaacgcctctgacagaagaaggcgttacacctctgctgactgtagacgtatgg
gaacatgcctactacatcgattaccgtaacgttcgtccagactacatggcagcgttctgg
aacctggttaactgggatttcgtaaacagcaacttcgctggttaa

DBGET integrated database retrieval system