KEGG   Shewanella marisflavi: CFF01_11075Help
Entry
CFF01_11075       CDS       T05400                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
smav  Shewanella marisflavi
Pathway
smav00020  Citrate cycle (TCA cycle)
smav00190  Oxidative phosphorylation
smav00650  Butanoate metabolism
smav01100  Metabolic pathways
smav01110  Biosynthesis of secondary metabolites
smav01120  Microbial metabolism in diverse environments
smav01130  Biosynthesis of antibiotics
smav01200  Carbon metabolism
Module
smav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smav_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFF01_11075 (sdhB)
   00650 Butanoate metabolism
    CFF01_11075 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFF01_11075 (sdhB)
Enzymes [BR:smav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFF01_11075 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CFF01_11075 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ASJ97083
UniProt: A0A220PWZ5
LinkDB All DBs
Position
complement(2530199..2530906)
Genome map
AA seq 235 aa AA seqDB search
MNLKIAIYRYNPEVDTKPYMKDYTLEVAEGTDMMVLDVLMQLKVQDPTLAFRRSCREGVC
GSDGVNMNGKNGLACITPISTFKGKKLEIRPLPGMPVVRDLIVDLTQFYKQYEKIKPYLI
NDEKTPAREHLQSPEERAHLDGLYECIMCACCSTACPSFWWNPDKFVGPSGLLHAYRFLI
DSRDTATEERLSELDDAYSVFRCHGIMNCVDVCPKGLNPTKAIGHIKSMLLKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaagattgctatttatcgctataatcctgaagtagacactaagccttacatg
aaggattacacgctggaagtggctgaaggtaccgatatgatggtattggatgtcctgatg
cagctgaaggttcaagacccaacgttggcgttccgtcgctcatgccgtgaaggtgtatgt
ggtagtgatggcgtgaacatgaatggtaagaatggtctggcttgtattacgcctatttct
accttcaagggtaagaaactggaaatacgtccactgccgggtatgcctgttgtgcgtgac
ctgattgtcgacctgactcagttctacaagcagtatgagaagatcaaaccttacctgatc
aacgatgaaaagacaccagctcgtgagcatctgcaatcgccagaagagcgtgcgcactta
gatggtctttatgagtgtatcatgtgtgcgtgttgttcaacggcttgtccatcattctgg
tggaacccagacaagttcgtcggaccaagcggcctgttgcatgcttatcgtttccttatc
gatagccgcgataccgcgaccgaagagcgtttgtctgagcttgacgatgcatacagcgta
ttccgttgccatggcatcatgaactgtgttgatgtgtgtccgaaaggactcaacccgacg
aaagcaattggacacattaagtccatgttgctgaagcgagcagtataa

DBGET integrated database retrieval system