KEGG   Shewanella marisflavi: CFF01_11080Help
Entry
CFF01_11080       CDS       T05400                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
smav  Shewanella marisflavi
Pathway
smav00020  Citrate cycle (TCA cycle)
smav00190  Oxidative phosphorylation
smav00650  Butanoate metabolism
smav01100  Metabolic pathways
smav01110  Biosynthesis of secondary metabolites
smav01120  Microbial metabolism in diverse environments
smav01130  Biosynthesis of antibiotics
smav01200  Carbon metabolism
Module
smav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smav_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFF01_11080
   00650 Butanoate metabolism
    CFF01_11080
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFF01_11080
Enzymes [BR:smav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFF01_11080
    1.3.5.4  fumarate reductase (quinol)
     CFF01_11080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA HI0933_like Pyr_redox_2 FAD_binding_3 DAO Thi4
Motif
Other DBs
NCBI-ProteinID: ASJ97084
UniProt: A0A220PX69
LinkDB All DBs
Position
complement(2530917..2532683)
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAIVIGAGGAGMRAALQISKEGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDFIGDQDAIEFMCQTGPEAIIELEHMGLPFSRFENGKIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKHKTEVFSEWYALDLVKNEDGAIVGC
TAIEIETGEIVYFKSKATILATGGAGRIYASTTNAHINTGDGVGMAMRAGVQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGLDGPLGPHCLLKLDHLGKETLEARLPGVCELSRTFAHIDPADGPIPVLPTCHYMMGGL
PAKVSGQVIRKNEDGSETDVSGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGQHLG
KALDETADPKDATDADIAKSLERLNRWESNKDGEDPAKIRKDLQLCMQLNFSVFRSGDAM
AEGLEELKAIRERLANAKLSDNSKEFNTQRIECLELDNLMATAIATAYAANFRKESRGAH
SREDYLERDDDNWLCHSLFDPVTEQMTKRAVNMEPKLREAFPPIKRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattccagttcgtgaatttgatgcaatcgtaattggcgccggtggcgcgggtatg
cgagctgcactacagatttctaaagaaggtaagagctgcgcgctgttatctaaagtattt
ccaacgcgttctcataccgtttcagcccagggtggtattaccgtagccctaggaaacgcc
catgaagaccattgggaacaacacatgtacgatacggtaaaaggttccgatttcatcggt
gaccaagacgctatcgaatttatgtgtcaaaccggtccagaagccattatcgagcttgag
catatgggtctaccattctctcgtttcgaaaacggtaagatctatcagcgtccttttggc
ggccagtctaaaaacttcggtggcgagcaagcagctcgtaccgctgctgcggccgaccgt
actggtcacgcgctactccactgcctataccagcagaacgttaagcataagactgaagtc
ttctctgagtggtacgcactggatctcgtgaaaaacgaagatggtgctatcgttggctgt
actgcaatcgaaatcgaaaccggtgagattgtttacttcaagtctaaagccactatctta
gcgacaggtggtgctggccgtatctacgcctctaccactaacgctcacatcaacacgggt
gacggcgtcggtatggcgatgcgcgctggtgtgcagatgcaagatatggaaatgtggcag
ttccacccaaccggtatcgccggcgcgggtgtactggtcactgaaggctgtcgtggtgaa
ggcggatatctgctaaacaaagacggcgagcgtttcatggagcgttatgcgccaaacgcg
aaagacttagcatcgcgtgacgtggttgcgcgttctatgatgactgaaattcgtgaaggt
cgtggtctcgatggcccattaggtcctcactgtctattgaaacttgatcacttaggtaaa
gagaccctcgaagcacgtctacctggcgtatgtgaactgtctcgtaccttcgcgcatatc
gatccggccgatggcccaatccctgtattgccaacctgtcactatatgatgggtggtcta
cctgctaaggtgagcggtcaggtgattcgtaagaatgaagacggcagcgaaactgatgtt
tctggtctgtttgccgtgggcgaaattgcctgtgtatcggttcacggtgccaaccgtctc
ggtggtaactcgctacttgaccttgtggtctttggccgcgcagcgggtcaacacttgggt
aaggcgttggatgagactgctgatcctaaagatgctaccgatgccgacatcgcgaaatca
cttgagcgtctaaaccgttgggaaagtaacaaagacggtgaagatcctgcgaagatccgt
aaagatcttcagttgtgtatgcagcttaacttctcagtattccgtagcggtgacgccatg
gcagaaggtctcgaagagcttaaggcgattcgtgagcgtttggccaatgccaagttgtct
gataactcgaaagagttcaacactcagcgtatcgagtgtctagagctggacaacctgatg
gcaacagccatcgccacggcttacgcggctaacttccgtaaagagagtcgtggggcgcac
tcacgcgaagattacctcgagcgtgatgatgacaactggttatgccacagcctgttcgat
cctgtgacagagcagatgaccaagcgtgcggtgaacatggagcctaagcttcgtgaagcc
ttcccgccaatcaagcgtacctactaa

DBGET integrated database retrieval system