KEGG   Shewanella marisflavi: CFF01_15535Help
Entry
CFF01_15535       CDS       T05400                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smav  Shewanella marisflavi
Brite
KEGG Orthology (KO) [BR:smav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CFF01_15535
Enzymes [BR:smav01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CFF01_15535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 NAD_binding_7 K_oxygenase FMO-like Glutaredoxin Spermine_synth Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ASJ97888
LinkDB All DBs
Position
complement(3519637..3521202)
Genome map
AA seq 521 aa AA seqDB search
MLDANVKNQLTTYLQNLKRPVELVVSADERPKAQELMALAKDIASLSDLVSLTESEGVRT
PSMTITNADSASQIHFAGLPMGHEFTSLVLALLHTGGHPIKLAPEVIEQIRDLPGEYRFE
TYISLSCQTCPEVVQALNMMAAINPNIQNTMIDGALFQDEVNERNIMAVPSVYLNGEPFS
VGGISVVEILNKLDVNAASRQAEKLNQKEAFDVLVVGGGPAGASAAIYAARKGLRTGILA
DKFGGQVAETVGIENFISVKATEGPKLVANLESHVHDYDVDIMDNQRALSLKSGELFEIQ
TESGALLRSKTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNIEIITQAMTTEVVGDGKRVQG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTLDLTERGEIMVDAKGQTSLPGVFAA
GDVTNSAYKQIIIAMGSGATASLGAFDYLIRLGEPADAVAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatgtaaaaaatcagctgactacctatctgcaaaacctcaagcgccca
gttgaacttgtcgtatcggcagatgagcgtcctaaagcacaagaattaatggcgttggca
aaagatattgcctcgttgtcggatctcgtatcgttgaccgaatcagagggtgtacgtacc
ccgtcgatgaccatcactaatgccgatagcgcgagtcagatccactttgccggtttgccg
atgggccatgaatttacatccttggtgctggcattgctgcacacgggtggccatccgatc
aagcttgcgcctgaagtgatagagcagatccgtgacctgccaggtgaatatcgcttcgag
acttatatatcgctgagctgtcaaacctgtcccgaggtggtgcaggcgcttaatatgatg
gcggcaatcaaccctaatattcaaaacaccatgatagatggcgccttgttccaggatgaa
gtgaacgagcgcaacatcatggcggtaccttctgtttaccttaatggcgagccgttttca
gtgggtgggatcagcgttgtcgagatccttaacaagctggacgttaatgcggccagccgc
caagcggaaaagttaaatcagaaagaggctttcgacgtgttagtggtcggtggtggcccg
gctggcgcctcggcagcgatctatgcggcgcgtaagggcttaagaaccggtatcctggcg
gacaaatttggcggccaggtggccgaaaccgtaggaattgaaaactttatctcggtgaaa
gccaccgaaggcccaaagttagtggctaatctcgaatctcatgtgcatgactatgatgtc
gatatcatggataaccagcgtgccttaagtctcaagtccggtgagttgtttgagatccaa
accgaaagtggcgcactactgcgcagcaaaacggtacttctggccacaggcgctcgctgg
cgcgagatgaatgtgccgggcgagaaagaatatcgcggcaaaggcgtcgcctactgccca
cactgtgacggcccgctgtttaagggcaagcgcgtcgccgtgattggcggtggtaactcg
ggcatagaggcggccatcgatctggccaatatcgttgagcatgtcactgtgcttgagttt
gacagcaagctgcgcgccgatgacgtgttacaacgcaaggcagcctctatgggcaatatt
gagataatcacccaggccatgacgacggaagtggtcggcgatggcaagcgagtgcaagga
ctgaactataccgatagggcaacaggtgaaagtcatcatatcgccctcgccggtatcttc
gtgcagattggcttggtacctaatgccgagtggctcaagggcacactcgacttgaccgag
cggggcgagatcatggtcgatgccaagggtcaaacctcactgcccggcgtatttgccgca
ggtgatgtgactaactctgcctataagcagatcatcatcgccatgggtagcggtgcaacc
gcttcgcttggcgcattcgactacctgatccgtctgggtgagccggcagacgcagtcgct
gcttaa

DBGET integrated database retrieval system