KEGG   Shewanella marisflavi: CFF01_17320Help
Entry
CFF01_17320       CDS       T05400                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase II
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
smav  Shewanella marisflavi
Pathway
smav00061  Fatty acid biosynthesis
smav00780  Biotin metabolism
smav01100  Metabolic pathways
smav01212  Fatty acid metabolism
Module
smav_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:smav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CFF01_17320
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CFF01_17320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:smav01004]
    CFF01_17320
Enzymes [BR:smav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     CFF01_17320
Lipid biosynthesis proteins [BR:smav01004]
 Fatty acid synthase
  Component type
   CFF01_17320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ketoacyl-synt_C ketoacyl-synt Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ASJ98208
UniProt: A0A220Q0F2
LinkDB All DBs
Position
3933564..3934751
Genome map
AA seq 395 aa AA seqDB search
MTQIAITHLGLSTPLGDDPQTVLRHLLDGDTQGMQWRDDLIPDTRVLVGMVNSALPSIAP
ELQRFDCRNNQLLQCAAEQIAPAVEQAKQQYGADRIGIVLGTSTSGIAKGEKALAYRAEH
GVLPADYLYSKQELGNSCDFLQHYFDLTGPCYTVSTACSSSAKVFASAKRLLLAGVCDMV
IVGGADSLCKLTLNGFHSLESVSKAHCQPFSRNRDGINIGEGAALFTLTLGKAELMLAGV
GESSDAHHISSPHPEGTGAVAAIEMALQDAGIAPSQVGYVNLHGTATMKNDAMESRALLK
VFGEHIPPVSSTKPLTGHALGAAGALEAAFCLLLLSQYNDQQALPPQVGDQEWDGDNPEL
PFVTPGQTQALDYIMSNSFAFGGSNASVIFCRGES
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacacagatagctatcacccacttaggattatccacaccactgggcgatgatccccaa
acagtcctgcgccacctgctcgacggcgatacccagggcatgcagtggcgtgacgacctg
atcccagacactcgcgtactcgtgggcatggtgaactcagcgctgccgagcatagcacct
gagctacagagatttgactgtcgcaacaaccagctgctccaatgcgccgccgaacagatc
gccccagccgtcgaacaagccaagcagcaatacggcgccgatcgcataggtatcgtctta
ggcaccagcacgtcggggatcgccaaaggcgagaaggcgctggcctaccgcgccgaacat
ggtgtcctgccagccgattacctctactctaaacaggagctaggcaacagttgcgacttt
ctgcagcactattttgacctcaccggcccctgctatacggtatcgaccgcctgctcctcc
agtgccaaggtgttcgccagcgccaagcgcctactactggctggcgtgtgcgacatggtg
atcgtcggtggtgccgatagcctgtgtaagctcaccctaaacggttttcactcgctggag
tctgtctctaaggcccattgccaaccttttagccgcaaccgcgacggcattaatatcggt
gaaggcgccgccctgttcaccctcaccttaggcaaggccgagctgatgctggccggtgtg
ggagaatccagcgatgctcaccatatctcctcaccccaccctgaaggcacgggcgcggtt
gccgccatcgagatggcgctgcaagatgccggtatcgccccatcacaggtgggctatgtc
aacttacatgggacggcaaccatgaaaaatgacgccatggagagccgagctttacttaag
gtctttggcgagcatatccccccagtgagttctaccaagcccctgaccggacacgccctg
ggcgctgccggcgccttggaagccgccttctgcctgctcttactgtcacaatataatgat
cagcaagcactgcctcctcaggtaggcgatcaagagtgggatggcgacaaccctgagctt
ccttttgttacgccgggtcaaacccaggcactcgactacatcatgagtaactcctttgcc
ttcggtggcagtaatgccagcgtgatcttctgccggggagagagctaa

DBGET integrated database retrieval system