KEGG   Sphingopyxis macrogoltabida 203: LH19_02510Help
Entry
LH19_02510        CDS       T04627                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smaz  Sphingopyxis macrogoltabida 203
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH19_02510
Enzymes [BR:smaz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LH19_02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored FAD_binding_2 Thioredoxin_3 HI0933_like DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 Thi4 NAD_binding_7 K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: ALJ11729
UniProt: A0A0P0CXJ0
LinkDB All DBs
Position
479517..481100
Genome map
AA seq 527 aa AA seqDB search
MLDANLKQQLQGLLTNLREPIELIASLGDDAKSAELAGLLDDIAALSDKVSVTRADDDAR
RPSFLIRRTGDANVAVRFAGIPMGHEFTSLVLALLQVGGHPPKVAPEVLEQVAALDGDYH
FETYFSLSCQNCPDIVQALNLMSVVNPRITHTAIDGGLFQAEVEDRKIMAVPTIFLNGEN
FGQGRMELEQIIAKLDSGAEAKAAEKIAAKEAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVQHTEGPKLVAQLEQHVKDYDVDIMNLQRAEKLIPAKTEG
GLHEVKLASGASLKARTVILSTGARWRQLGVPGEDAYRNKGVAYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGLVAHVTLIEYDSELRADAVLQRKLASLPNVKIITSALTTEVLGD
GEKVTGLSYKDRNKDELHQIELEGIFVQIGLVPNTEWLKDSVTLSRHGEIEVDHRGETSQ
KGIFAAGDCTTVPYKQIVIAMGEGSKAALSAFDYMIRLPAEVEAAAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctgaagcagcagcttcaaggcctcctcacgaatcttcgtgaaccg
atcgaactgatcgcgtcgctgggcgacgatgccaagtcggccgagctggcgggcctcctc
gacgatatagccgcgctgtcggacaaggtcagcgtgacccgcgccgacgacgatgcgcgc
cgccccagcttcctgatccgccgcaccggcgacgccaatgtcgcggtccgtttcgccggc
atcccgatggggcatgaattcacttcgctcgtcctcgcgctgctccaggtcggcggccat
ccgccgaaggtggcgcccgaggtgctggagcaggtcgcggcgctcgacggcgactatcat
ttcgagacctatttctcgctgtcgtgccagaactgccctgacatcgtgcaggcgctcaac
ctgatgagcgtcgtcaacccgcgcatcacccacaccgcgatcgacggcgggctgttccag
gccgaggtcgaggatcgcaagatcatggcggtgccgacgatcttcctgaacggcgagaat
ttcggtcagggccgcatggagctcgaacagataatcgcgaagctcgacagcggcgccgag
gccaaggccgccgagaagatcgccgccaaggaggcgtttgacgtgctcgtcgtcggtggc
ggccccgcgggtgccgcggccgcgatctatgcggcgcgcaagggcatccgcaccggcatc
gcagccgagcgcttcggcgggcaggtgctcgacacgatggcgatcgagaatttcatctcg
gtccagcacaccgaagggccgaagctggtcgcgcagctcgaacagcacgtcaaagactat
gacgtcgacatcatgaacctgcaacgcgccgagaaactgatccccgcgaagaccgaaggc
ggcctgcacgaagtgaagctcgccagcggcgcatcgctgaaggcgcgcaccgtgatcctc
tcgaccggcgcgcgctggcgccagctcggcgtgccgggcgaggatgcctatcgcaacaag
ggcgtcgcctattgcccgcattgcgacggcccgctctacaagggcaagcgcgtcgcggtg
attggtggcggcaacagcggtgtcgaggcggcgatcgaccttgccggcctcgtcgcgcac
gtcacgttgatcgagtatgacagcgagctgcgcgccgatgcggtgttgcagcgcaaattg
gccagcctgcccaacgtcaagatcatcacctcggcgctgaccaccgaagtgctcggcgac
ggcgagaaggtgacgggactttcgtacaaggaccgcaacaaggacgaactgcaccagatc
gagctcgaaggcattttcgtccagatcggcctcgttccgaacaccgaatggcttaaggac
agcgtcaccctgtcgcgccacggcgagatcgaagtcgatcatcgcggcgagacaagccag
aagggcatcttcgcggcgggcgactgcacgacggtgccgtacaagcagatcgtcatcgcg
atgggcgaagggtcgaaggcggcgctgtcggcgttcgactatatgatccgcctgccggcc
gaggtggaagccgcggcggcgtag

DBGET integrated database retrieval system