KEGG   Sphingopyxis macrogoltabida 203: LH19_02525Help
Entry
LH19_02525        CDS       T04627                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smaz  Sphingopyxis macrogoltabida 203
Pathway
smaz00564  Glycerophospholipid metabolism
smaz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LH19_02525
Enzymes [BR:smaz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LH19_02525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_2 AlaDh_PNT_C GIDA HI0933_like NAD_binding_8 GAD Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALJ11732
UniProt: A0A0P0DIX7
LinkDB All DBs
Position
complement(482878..484395)
Genome map
AA seq 505 aa AA seqDB search
MPDSAQPYDVIVVGGGVNGAGVARDAAGRGARVLLLEAGDLAQGTSSKSTKLIHGGLRYL
EHYEFGLVREALKEREILWSIAPHIIWPLRFVLPYRTGLRPRWLLRLGLFLYDHIGGRKK
LPATRSIDLAQHEAGTPLQSQYVRAFEYSDGWVDDARLVLLNARDAAERGARIRTRTRAE
TMRVEGGLWVVEGSDDRGHRYRFTGKSLVNAAGPAVLDLLARASAPPDYRMRLVRGSHIV
VRRKFAHDYAYFFQLPDGRIFFAIPYERDFTLIGTTDRDHDGPLAEVHASADEIAYLCEG
ASEYFREPVTPADVVWTYSGVRPLIEDGSGRPEAATRGYRIDIDVDEGAPLLTIYGGKIT
SYRHVAEHAVDELAGHLDAVSTRRWTAKTPLPGGDFGIDGAAALKAEYKLAHPFLPAATV
DRVVKAYGTDARAWLGKAEDWDALGGEIAHGLSAAEAQWMIEREWARDVEDILWRRSKLG
LLFGADDVAKLAAWLQARRPAGQPA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacagcgcgcagccttatgatgtcatcgtcgtcggcggcggtgtcaacggcgcc
ggcgtcgcgcgcgatgccgccggacgcggcgcgcgcgtgctgctgctcgaagccggcgac
cttgcgcagggcacttcgtcgaaatcgaccaagctgatccacggcgggctgcgctatctc
gaacattatgaattcggcctcgtccgcgaggcgctgaaagagcgcgaaatcctgtggagc
atcgcgccgcacatcatctggccgctgcgcttcgtcctgccctatcgcaccggcctccgc
ccgcgctggctgctcaggctcggcctgtttctctacgaccatatcggcgggcggaaaaag
ctgcccgcgacgcgctcgatcgatctggcgcagcacgaagcgggcacgccgctccaatca
caatatgtccgtgcgttcgaatattcggacggctgggtcgacgatgcccggctcgtgctg
ctcaacgcgcgcgatgccgccgagcgcggtgcgcgaatccggacgcgcacccgcgccgaa
accatgcgcgtcgagggcgggctatgggtggtcgagggcagcgacgatcgcgggcatcgc
tatcgcttcaccggcaaaagcctggtcaacgcggcgggcccggcggtgctcgacctgctt
gcgcgcgcctcggcgccgcccgattaccggatgcggctggtgcgcggctcgcacatcgtc
gtgcgccggaagttcgcgcacgactatgcctatttcttccagcttcccgacgggcgcatt
ttcttcgccattccctatgagcgcgacttcacgctgatcgggacgaccgaccgggatcat
gacgggccgctcgcagaggtgcatgcaagcgccgacgagatcgcctatctctgcgaaggc
gccagcgaatatttccgcgagccggttacccccgccgatgtcgtctggacctattcgggg
gtacggccgctgatcgaggacggatcgggccgccccgaagccgcgacgcgcggctaccgg
atcgatatcgacgtcgacgaaggcgcgccgctgctcaccatttatggcggcaagatcacc
agctatcgccatgttgccgaacatgccgtcgacgaactggcaggccatctcgatgccgtg
tcgaccagacgctggaccgcgaaaacgccgcttcccgggggggatttcgggatcgacggc
gccgccgcgctcaaggccgaatacaagctcgcccatcccttcctgcccgccgcgacggtc
gaccgggtggtcaaggcctatggcaccgacgcccgcgcctggctcggcaaggccgaagac
tgggacgcgctgggcggcgagattgcccacggcctcagcgcggccgaagcccagtggatg
atcgagcgcgaatgggcgcgcgacgtcgaggatatcctttggcgccgcagcaagctggga
ttgctgttcggtgcggatgacgtcgcgaagctggcggcctggctgcaagcgcggcgaccg
gcgggccagccggcctga

DBGET integrated database retrieval system