KEGG   Sphingopyxis macrogoltabida 203: LH19_03040Help
Entry
LH19_03040        CDS       T04627                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
smaz  Sphingopyxis macrogoltabida 203
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALJ11835
UniProt: A0A0P0DJ65
LinkDB All DBs
Position
606524..608008
Genome map
AA seq 494 aa AA seqDB search
MIGQANAQVAHPDRLFIGGRWIPVEGSARFTVTNPATEEAFGEVVAAGAPEVERAVAAAR
KAFDEGPWPRMSAAERATYMRALSQALQRRGAALDSAWISQVGVPIWMAQGSGAGTAGLL
DYYAGLAEAYPFEDVRPSNGMMSKVAVVVREPVGVVAAIAPWNGPLASLLIKLAPALATG
CTVILKPAPETPLEAFMLAEAAEEAGFPEGVINLLPADREASDLLIRHPGVDKVAFTGST
EVGLHIAQVCAGRMARFTMELGGKSAAIVLDDFEPEAMGPALAPMITLLCGQVCINFSRV
LVPRARKDAYVESLAAAMAATSIGDPLDANTMMGPLAMARHHAKVSSYFDKGVAEGARIA
TGGRRPPALNSGYYVEPTVFADATNDMAIAQEEIFGPVTAVIPYDSVEEAIAIANDSQFG
LSGGVYTHDTDRAYGVARRIRTGHFTQNGRDFDLTNPFGGFKKSGVGREGGPEGIEPFTE
VKTVFLPQAPSVLA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccaagccaacgcgcaggtggcgcatcccgaccggcttttcatcggcggacgc
tggattcccgtcgagggtagcgctcgcttcaccgtgaccaaccccgcgaccgaggaagcg
ttcggcgaagtcgtcgcggcaggcgcgcccgaggtcgagcgcgcggtcgcggcggcgcgc
aaggcgttcgacgagggtccttggccgcggatgtccgccgccgagcgcgcaacctacatg
cgcgccttgtcgcaggcgctgcagcgccgcggcgccgcgctcgacagcgcgtggatttcg
caggtcggggtgccgatctggatggcgcagggctcgggggcgggcaccgcggggctgctc
gattattatgccgggctcgccgaggcctatccgttcgaggatgtccgcccgtcgaatggc
atgatgtcgaaggttgcggtagttgtgcgtgagcctgtcggcgtcgtcgcggcgatcgcg
ccgtggaacggcccgctcgcctcgctgctcatcaagctcgctcccgcgctcgcgaccgga
tgcaccgtcatcctgaaacccgcgcccgaaaccccgctcgaggcgttcatgctcgccgag
gccgccgaggaggcgggcttccccgaaggtgtgatcaacctgctgcccgccgaccgcgag
gcgtcggacctgctcatccgccatcctggcgtcgacaaggtcgccttcaccggctcgacc
gaggtcgggctgcatatcgcgcaggtctgcgccggccgcatggcgcgcttcacgatggaa
ctgggcggcaagtcggcggcgatcgtgctcgacgatttcgagcccgaggcgatgggcccc
gcgctggcgccgatgatcaccctgctctgcggccaggtgtgcatcaatttcagccgcgtg
ctcgtgcccagagcgcgcaaggatgcctatgtcgaaagccttgccgcggcaatggcggcg
accagcatcggcgacccactcgacgcgaacacgatgatgggcccgctcgcgatggcgcgg
caccatgccaaggtgtcgagctatttcgacaagggcgtcgccgagggcgcgcgcatcgcc
accggcggccgccgcccgcccgcgctcaacagcggctattatgtcgagccgacggtgttc
gctgatgcgaccaacgacatggcgatcgcacaggaggaaatcttcggccccgtcactgcg
gtcatcccctatgacagcgtcgaggaagcgatcgctatcgccaacgacagccagttcggc
ctgtcgggtggcgtttatacgcacgacaccgatcgcgcctatggcgtcgcgcggcgtatc
cgcaccggccatttcacccagaacgggcgcgatttcgacctgaccaatcccttcggcggc
ttcaagaaatcgggcgtcgggcgcgagggcggacccgaaggcatcgagcccttcaccgag
gtcaagaccgtgttcctgccgcaggcgccgagcgtactcgcatga

DBGET integrated database retrieval system