KEGG   Sphingopyxis macrogoltabida 203: LH19_07645Help
Entry
LH19_07645        CDS       T04627                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
smaz  Sphingopyxis macrogoltabida 203
Pathway
smaz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smaz01100  Metabolic pathways
smaz01110  Biosynthesis of secondary metabolites
smaz01130  Biosynthesis of antibiotics
smaz01230  Biosynthesis of amino acids
Module
smaz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LH19_07645
Enzymes [BR:smaz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     LH19_07645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ALJ12739
UniProt: A0A0P0D5I9
LinkDB All DBs
Position
complement(1482034..1483032)
Genome map
AA seq 332 aa AA seqDB search
MSRFGPFPDPSALLDHDEAADAFATMLDGGATDEQVTEFLIALSDRGETMVEIAAAAQAM
RDRLIPVAAPAGAIDVCGTGGDGHHTLNVSTAVSIVVAACEVPVAKHGNRAASSKSGAAD
TLEALGLDMERADRQAEAQLADLGICFLFAGTRHPAMKRIMPIRKAIGRRTIFNLMGPLA
NPARVTRQLIGIARPAYVPVYAEALHRLGTDHSRVISGDEGLDELSLAGGNEVAVITPEG
VRMQRSEAADAGLPTRSLDEIRGGDADYNAKALRALLQGEPGAYRDAVLYNAAEALVVAG
AADTLHEGVEEAAEAIDKGLANALLNCWIAYK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagccggttcgggccctttcctgacccctcggcgcttctcgatcacgacgaagcggcc
gatgccttcgcgacgatgctcgacggcggcgcgaccgacgagcaggtgaccgaatttctg
atcgccctctccgatcgcggtgaaacgatggtcgaaatcgctgccgccgcgcaggcgatg
cgcgaccggctgatccccgtcgcggcgcccgctggcgcaatcgacgtttgcggcaccggc
ggcgatggccatcatacgctcaacgtctcgaccgccgtgtcgattgttgttgccgcatgt
gaagttcccgtcgcaaagcacggaaatcgggcggcttcgtcgaagtctggcgccgccgac
accctggaagcactggggctcgacatggagcgcgccgaccggcaggccgaggcgcagctc
gctgatcttggtatctgcttcctcttcgccgggacgcgtcaccccgcgatgaagcgcatc
atgccgatccgcaaggcaatcgggcggcggacgatcttcaacctcatgggcccgctcgcc
aaccccgcgcgcgtcacgcgccagctcatcggcatcgcacgccccgcctatgtccccgtc
tatgccgaagcgctgcaccggctcggcaccgaccattcgcgcgtcatttcgggcgacgag
gggctcgacgagctgtcgctggccggcggcaacgaggtcgcggtgatcacgcccgagggc
gtccggatgcaacgcagcgaggcggccgatgccggtcttccgacgcggtcgctcgacgag
attcgcggcggcgacgcggattataacgcgaaagcgctgcgcgccctgctgcaaggcgaa
cccggcgcgtatcgcgacgccgtactctataacgccgccgaagcgctcgtcgtcgctggc
gccgccgacacattgcacgagggtgtcgaggaggctgccgaggcgatcgacaagggcctt
gccaacgcgctgctcaattgctggatcgcctataaatga

DBGET integrated database retrieval system