KEGG   Sphingopyxis macrogoltabida 203: LH19_13895Help
Entry
LH19_13895        CDS       T04627                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smaz  Sphingopyxis macrogoltabida 203
Pathway
smaz00473  D-Alanine metabolism
smaz00550  Peptidoglycan biosynthesis
smaz01100  Metabolic pathways
smaz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LH19_13895
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LH19_13895
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    LH19_13895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smaz01011]
    LH19_13895
Enzymes [BR:smaz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LH19_13895
Peptidoglycan biosynthesis and degradation proteins [BR:smaz01011]
 Precursor biosynthesis
  Amino acid ligase
   LH19_13895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALJ13961
UniProt: A0A0P0DQ45
LinkDB All DBs
Position
complement(2753439..2754365)
Genome map
AA seq 308 aa AA seqDB search
MSRGPWHVAVLMGGWSAEREVSLMSGKGVADALESRGHKVTRIDMDRDVALRLAEAKPDV
VFNALHGVPGEDGTVQGMLDLMGLKYTHSGLVTSVIAIDKELTKQALVPHGIPMPTGTMV
DSESLFSIDPLPRPYVLKPVNEGSSVGVAIVRDDSNYGNPIARDAVGPWQEFDRLLAEPF
IKGRELTVAVLADKALAVTELRVKSGFYDYDAKYTDGLTEHVCPAEVPEDVAQRMKDLAL
QAHRLLGCKGASRSDFRWDDEHGLAGIFLLEVNTQPGMTPLSLVPEQGRAVGMDYAELVE
RIVGEALS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggggtccgtggcatgtcgccgtcctgatgggcggctggtcggcagagcgcgaa
gtgtctctgatgagcggcaaaggcgttgccgatgcgctcgaatcgcgcggccacaaggtc
acgcgcatcgacatggaccgcgacgtggcgctgcggcttgccgaggcgaagcccgacgtc
gtcttcaatgcgctccacggcgtcccgggtgaagacgggacggtgcagggcatgctcgac
ctgatggggctcaaatatacccatagcgggctcgtcacctcggtgatcgcgatcgacaag
gaattgacgaagcaggcgctcgtcccgcatggtatcccgatgccgacggggacgatggtc
gacagtgaaagcctcttttcgatcgacccgctgccgcgtccctatgtcctgaaaccggtc
aacgagggctcgtcggtcggcgtcgccattgtccgggacgacagcaattacggcaacccg
atcgcgcgcgacgccgtcggtccctggcaggagttcgaccggctgctcgccgagcccttc
atcaaggggcgcgaactgaccgtcgcggtgctcgccgataaggcgctggccgtcaccgaa
ctgcgggtgaagtcgggtttctatgactatgacgccaaatataccgacggcctgaccgag
catgtgtgccccgccgaggtgcccgaagatgtcgcgcagcggatgaaggacctcgcgctg
caggcgcatcgtctgctcggctgcaagggcgcttcgcgctccgatttccgctgggacgac
gagcatggcctcgcgggcatcttcctgctcgaggtcaatacccagcccggcatgacgccg
ctcagtctggtgcccgaacaggggcgcgccgtcggcatggattatgccgaactcgtcgaa
cgcatcgtgggggaagcgttatcatga

DBGET integrated database retrieval system