KEGG   Sphingopyxis macrogoltabida 203: LH19_24710Help
Entry
LH19_24710        CDS       T04627                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
smaz  Sphingopyxis macrogoltabida 203
Pathway
smaz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    LH19_24710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smaz03400]
    LH19_24710
Enzymes [BR:smaz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LH19_24710
DNA repair and recombination proteins [BR:smaz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     LH19_24710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ALJ16093
UniProt: A0A0P0E3S7
LinkDB All DBs
Position
4998470..5000986
Genome map
AA seq 838 aa AA seqDB search
MARADPLARYNAKRDFKLTPEPAGKVEKGAGNRFIVQKHDATRLHYDFRLEIDGVLKSWA
VTKGPSADPADKRLAVRTEDHPMSYADFEGVIPKGEYGGGTVMLWDRGTWAPIAGKSAKD
IEKGHLHFTLDGDRMKGEWLLVRMKPRPGEKRENWLLRKVDDAFAGGTDDLVGRRLTSVL
TDRTMADIAADKGGEQSLQGAKGAAFAKKMAAAAAHNKQVAKPVAKPKASGKPPKFRPLQ
LATLVDAVPTGNGWFHEIKYDGYRAEIAASGGDVRVFTRNGLDWTDKFAPLVRHIAALDL
PPCLIDGEIVAYGKDGNPDFSALQAVLKRGHGAQDEATALHLFAFDLIEQDGKSLAKLGN
LERKERLEALLRGARPPIAVADHVIGAGETLYAAMCGAGQEGIISKRADAAYSGRRSKNW
VKVKCTRRQEFILVGWNPSSAKGRAFASLLLAQREKGKLVYKGNVGTGFDAAMMADLAKK
FAARERKTAPVDVDAAVARKVHWLKPDLVAEIAFAEFTAGGSVRHASFLGLRRDKEAKEV
TPEKQQPAPEPASDVTISSRDRVIFPEAKATKGDLADYYAAIAPVMLPHMARRPISLVRC
PQGRAKKCFFQKHDSGSFGDHVHHIPIREKDGGHEDYLYVDDADGILACVQMGTIEFHGW
GSHAGALEKPDRMVFDLDPDEGLAFADVKKAAADIRRQLADIGLVSFAMLSGGKGVHVVV
PLDPGHDWDAHKDFSKRFAEALSLAEPDRYVATMSKAKRKGKIFIDYLRNQRGSTAIMPY
SARARENAPVAVPVGWDALADIESAGAWTIRDAAALLERAGSAELKGWGFAGQKLPAL
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgccgatcctcttgcccgatataatgccaagcgcgacttcaagcttaccccc
gaaccggcggggaaggtcgaaaagggagccggcaaccgcttcatcgtccagaagcacgac
gcgacgcggctccactatgatttccggctcgaaatcgacggcgtgctcaaaagctgggcg
gtcaccaaaggcccgagcgccgatccggccgacaagcgtctcgcggtgcgcaccgaagac
catccgatgagctacgccgatttcgaaggcgtcatccccaagggcgaatatggcggcggc
acggtgatgctgtgggatcgcggtacctgggcgcccatcgcgggcaagagcgcgaaggat
atcgaaaagggccatctccatttcaccctcgacggcgaccggatgaagggcgaatggctg
ctcgtccgcatgaagccgcgcccgggcgagaagcgcgagaactggctgctgcgcaaggtc
gacgatgcttttgccgggggtaccgacgacctggtggggcgccggctcaccagcgtgctc
accgaccggacgatggccgacatcgccgccgacaagggcggcgaacagtcgctgcagggc
gcgaaaggtgcggctttcgcgaagaagatggccgccgccgccgcacataacaaacaggtc
gccaaacccgtcgccaagccgaaggcaagcggcaagccgccgaaattccgcccgctccag
ctcgcgacgctcgtcgatgcggtgccgaccgggaacggctggttccacgaaatcaaatat
gacggctatcgcgccgaaattgccgcatcggggggtgacgtccgcgtcttcacgcgcaac
ggtctcgactggaccgacaagttcgccccgcttgtccgccacatcgcggcgctcgatctg
ccgccgtgcctgatcgacggcgagatcgtcgcttatggcaaggacggcaatcccgacttc
tcggcgctgcaggcggtgctgaaacgcggtcacggcgcgcaggacgaggcgaccgcgctg
catcttttcgccttcgatctcatcgaacaggacggcaaatcgctcgccaaactcggcaat
ctcgaacgcaaggaacggctcgaagcgctgctccggggcgcccggcccccgatcgcggtc
gccgatcatgtcatcggcgccggtgagacgctctatgccgcgatgtgcggcgccgggcag
gagggcatcatctcgaagcgcgccgacgccgcttattcgggccgccgctcgaaaaactgg
gtgaaggtcaaatgcacccgccgccaggagttcatcctcgtcggctggaatccgtcatcg
gcgaagggccgcgcctttgcctcgctcctcctcgcccagcgcgagaaaggcaagctcgtc
tacaaaggcaatgtcggcaccggtttcgacgccgcgatgatggccgaccttgcgaagaaa
tttgcggcacgcgaacgcaagacggcgccggtcgacgtcgatgcggccgtcgcgcgcaag
gtccattggctgaagcccgatctggtcgccgaaatcgcctttgccgaattcacggcgggc
ggctcggtgcgccatgccagttttctcggcctgcgccgcgacaaggaggcgaaagaggtg
acccccgaaaagcagcagccggcgcccgagccggcgagcgacgtgacgatcagcagccgc
gaccgcgtgatctttcccgaggccaaggcgaccaagggcgatctcgccgactattacgcc
gcgatcgcgccggtgatgctgccgcacatggcgcgccgcccgatcagcctcgtccgctgt
ccgcaggggcgcgcgaaaaaatgcttcttccagaaacacgacagcggttcgttcggcgac
catgtccaccacatcccgatccgcgagaaagacggcgggcacgaggattatctttatgtc
gacgacgccgacggcattcttgcctgcgtccagatggggacgatcgagttccacggctgg
ggcagccatgcgggcgcgctcgaaaagcccgaccgcatggttttcgacctcgaccccgac
gaggggctcgcgttcgccgatgtgaaaaaggccgccgccgacatccgccgccagctcgcc
gacatcggcctcgtcagcttcgcgatgctgtcgggcggcaagggcgtccatgtcgtcgtg
ccgctcgatccggggcatgactgggatgcgcacaaggatttctcgaaacgctttgccgag
gcgctcagcctcgccgaacccgaccgctatgtcgcgacgatgagcaaggcgaagcgcaag
gggaagatcttcatcgattacctccgcaaccagcgcggcagcaccgcgatcatgccctat
tcggcgcgcgcccgcgaaaatgcgccggtcgcggtgccggtcggctgggatgcgctcgcc
gatatcgaaagcgccggggcgtggacgatcagggatgccgccgcactgctcgaacgcgca
ggcagcgccgaactcaagggctgggggtttgcgggccagaaacttccggcgctgtag

DBGET integrated database retrieval system