KEGG   Streptococcus mitis: smi_0289Help
Entry
smi_0289          CDS       T01173                                 

Gene name
aspC2
Definition
(RefSeq) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
smb  Streptococcus mitis
Pathway
smb00220  Arginine biosynthesis
smb00250  Alanine, aspartate and glutamate metabolism
smb00290  Valine, leucine and isoleucine biosynthesis
smb01100  Metabolic pathways
smb01110  Biosynthesis of secondary metabolites
smb01130  Biosynthesis of antibiotics
smb01210  2-Oxocarboxylic acid metabolism
smb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    smi_0289 (aspC2)
   00290 Valine, leucine and isoleucine biosynthesis
    smi_0289 (aspC2)
   00220 Arginine biosynthesis
    smi_0289 (aspC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smb01007]
    smi_0289 (aspC2)
Enzymes [BR:smb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     smi_0289 (aspC2)
    2.6.1.66  valine---pyruvate transaminase
     smi_0289 (aspC2)
Amino acid related enzymes [BR:smb01007]
 Aminotransferase (transaminase)
  Class I
   smi_0289 (aspC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha
Motif
Other DBs
NCBI-GeneID: 8797565
NCBI-ProteinID: YP_003445429
UniProt: D3H6R9
LinkDB All DBs
Position
284238..285452
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAAEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKELLLEIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDEML
LPGGRIYEQRNFIYNAIQEIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcttatgatatccgtggtcct
gttttggaagaagccatgcggatgcgagcaaacggagaaaagattttacgtctgaataca
ggaaatccagcagaatttggttttacagcgccagacgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaagggtattctgactccaaaggaattttctcagcccgtaaggct
atcatgcagtattgccaattgaagaaatttccaaacgtagatattgatgatatttacctt
ggaaatggtgtcagcgagttgattgttatgtccatgcagggacttttagacaatggagat
gaggtcttagttccaatgccagactatcctctctggacagcggctgtcagcctagctgga
ggaaatgccgttcactatatctgtgatgaagctgcagaatggtacccagatattgacgat
atcaagtcaaaaatcacttccaataccaaggcaatcgtccttatcaatccaaataatcca
actggagccctttatcctaaggaactcttgttggagattattgagattgcccgtcaaaac
gatttgatcatctttgcggatgaaatttacgatcgcatggtaatggatggacatgtgcat
acgcctgtggcgagcttggcaccagatgtcttctgtgttagcatgaatggtctatcaaaa
tcccaccgtatcgctggtttccgtgtaggttggatggtcttgtctggtcctaagacacac
gttaaaggctatatagaagggctcaatatgctttccaatatgcgcctttgctctaatgtt
ttggctcaacaagtcgtacaaacttccttggggggtcaccaatcagttgatgaaatgctc
cttcctggtggacgaatttacgagcaaagaaatttcatctacaatgctattcaagaaatt
ccaggtctctctgctgttaaacccaaggctggactctatatcttccctaaaatcgaccgc
aatatgtatcgtatcgatgatgatgagcagtttgtccttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgaggcttcaactggcaggaaccagaccacttccgtattgtt
taccttcctcgtgttgatgaactagcccaaatccaagaaaagatgactcgtttcttgaaa
cagtatcgtagatag

DBGET integrated database retrieval system