KEGG   Streptococcus mitis: smi_0750Help
Entry
smi_0750          CDS       T01173                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
smb  Streptococcus mitis
Pathway
smb00500  Starch and sucrose metabolism
smb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    smi_0750
Enzymes [BR:smb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     smi_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 8798740
NCBI-ProteinID: YP_003445865
UniProt: D3H805
LinkDB All DBs
Position
complement(702427..703881)
Genome map
AA seq 484 aa AA seqDB search
MQNQTLMQYFEWYLPHDGQHWTRLAEDAQHLADLGISHVWMPPAFKATNEKDVGYGVYDL
FDLGEFNQKGTVRTKYGFKEDYLQAIQALKAQGIQPMADVVLNHKAAADHMEAFQVIEVD
PEDRTVELGEPFTINGWTSFTFDGRQDTYNDFHWHWYHFTGTDYDAKRRKSGIYLIQGDN
KGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHID
SFFMRNFIRDMKEKYGDDFYVFGEFWNPDKEANLDYLEKTEERFDLVDVRLHQNLFDASR
AGSNYDLRGIFKDSLVELKPDKAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLRQNG
LPCVFYGDYYGISGQYAQQDFKEVLDRLLAIRKDLAYGEQTDYFDDANCIGWVRSGAENQ
SPIAVLISNDQENSKSMFIGQEWANQTFVDLLGNHQGQVTIDEEGYGQFPVSARSVSVWA
ANTI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaaacacttatgcaatactttgaatggtatctgccccacgacggccagcac
tggacgcgtctagctgaagatgctcaacacctagctgatctcggcattagtcatgtctgg
atgcccccagcttttaaggcaaccaatgaaaaagatgtaggctatggtgtctatgactta
tttgacttaggagaatttaatcaaaaaggaactgtccgcaccaagtatggttttaaagaa
gactatcttcaagccattcaagccctaaaagcgcagggaatccagcccatggccgatgtg
gtactcaaccacaaggctgcagccgatcacatggaagcctttcaggttatcgaagtggat
cctgaagatcgtacagttgaacttggagaacccttcaccatcaatggctggactagtttt
accttcgatggccgccaagatacctacaatgacttccactggcattggtaccacttcaca
ggtacagactatgatgccaaacgtcgtaagtctgggatttatctgatccaaggggacaac
aaaggctgggccaacgaggaattagtcgataacgagaacggaaactacgactacctcatg
tatgctgacctagactttaaacatcctgaagtcatccaaaatatctatgactgggctgac
tggttcatggaaacgactggtgtagctggtttccgcttggatgcagtcaaacacatcgat
tctttctttatgcgcaatttcatccgcgatatgaaggaaaaatacggtgacgatttctac
gtttttggtgaattttggaacccagacaaggaagccaatctagattatcttgaaaaaaca
gaagaacgctttgaccttgtcgatgttcgtctccaccagaatctctttgatgctagtcga
gcaggttccaactatgaccttcgtggcattttcaaagatagcctggttgaactcaaacct
gacaaggctgtgacatttgtcgacaaccacgatacacaacgaggtcaggctcttgagtct
accgttgaagaatggttcaaaccagcagcctacgccctcattctgttacgccaaaatggc
cttccatgtgtcttttacggcgactactatgggatttcagggcaatatgctcaacaagat
ttcaaagaagtccttgaccgcctcctagccatccgaaaagatttggcctatggagagcaa
acagactactttgatgacgcaaactgtatcggttgggtacgttcaggtgctgaaaatcaa
tccccaatcgcagtccttatctcaaatgaccaagaaaacagcaagtcaatgtttatcggc
caagaatgggctaaccaaacttttgtagatttacttggaaatcaccaaggtcaagttaca
atcgatgaggaaggttatggacaattcccagtctcagcaagatctgtaagtgtctgggca
gccaatactatttaa

DBGET integrated database retrieval system