KEGG   Streptococcus mitis: smi_0873Help
Entry
smi_0873          CDS       T01173                                 

Gene name
rpiA
Definition
(RefSeq) ribose-5-phosphate epimerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
smb  Streptococcus mitis
Pathway
smb00030  Pentose phosphate pathway
smb01100  Metabolic pathways
smb01110  Biosynthesis of secondary metabolites
smb01120  Microbial metabolism in diverse environments
smb01130  Biosynthesis of antibiotics
smb01200  Carbon metabolism
smb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    smi_0873 (rpiA)
Enzymes [BR:smb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     smi_0873 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-GeneID: 8797952
NCBI-ProteinID: YP_003445989
UniProt: D3H8C9
LinkDB All DBs
Position
828342..829025
Genome map
AA seq 227 aa AA seqDB search
MENLKKMAGIKAAEFVKDGMVVGLGTGSTAYYFVEEIGRRIKEEGLQITAVTTSSVTSKQ
AEGLNIPLKSIDHVDFVDVTVDGADEVDSQFNGIKGGGGALLMEKVVATPSKEYIWVVDE
SKLVEKLGAFKLPVEVVQYGAEQVFRCFERAGYKPSFREKSGQRFVTDMKNFIIDLALDV
IEDPIAFGQELDHIVGVVEHGLFNQMVDKVIVAGRDGVQILTSTKAN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaatctgaagaaaatggcaggtatcaaggctgctgagtttgtcaaggatggcatg
gttgtcggactaggaacaggttctactgcctattattttgtagaagaaatcggtcgtcgt
atcaaggaagaaggattgcagattacagctgtaacgacttccagtgtgaccagtaaacag
gctgaagggcttaatatcccactcaagtctattgaccatgtagactttgtcgatgtgacg
gttgatggggcagatgaagtggatagtcagtttaacggaatcaaaggcggtggtggtgcc
cttctgatggagaaagttgtcgcaacgccttcaaaagaatacatttgggtggtggatgaa
agcaagttagtagagaaactaggtgcttttaaattgcctgtggaagtggttcagtatggc
gcagaacaagtctttcgttgttttgaacgagctggctacaaaccaagtttccgtgaaaaa
tccggtcaacgttttgtgaccgatatgaagaattttatcatcgaccttgccttagatgtc
attgaagatccaattgctttcggacaagaattagaccatatcgttggtgtcgtggagcac
ggcttattcaaccaaatggtggataaggtcatcgttgctggacgagacggggttcagatt
ttaacttcaacaaaagcaaactaa

DBGET integrated database retrieval system