KEGG   Streptococcus mitis: smi_2033Help
Entry
smi_2033          CDS       T01173                                 

Gene name
glpF
Definition
(RefSeq) glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
smb  Streptococcus mitis
Brite
KEGG Orthology (KO) [BR:smb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smb02000]
    smi_2033 (glpF)
Transporters [BR:smb02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    smi_2033 (glpF)
Ion channels [BR:smb04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   smi_2033 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 8798686
NCBI-ProteinID: YP_003447129
UniProt: D3HBL9
LinkDB All DBs
Position
complement(2088836..2089540)
Genome map
AA seq 234 aa AA seqDB search
MMNELFGEFLGTLILILLGNGVVAGVVLPKTKSNSSGWIVITMGWGIAVAVAVFVSGKLS
PAHLNPAVTIGVALKGGLPWASVFPYILAQFAGAMLGQILVWLQFKPHYEAEENAGNILA
TFSTGPAIKDTVSNLISEILGTFVLVLTIFALGLYDFQAGIGTFAVGTLIVGIGLSLGGT
TGYALNPARDLGPRIMHSILPIPNKGDGDWSYAWIPVVGPVIGAALAVFVFSLF
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgaattatttggagaatttttggggactttaatcctgattcttctaggaaat
ggtgttgtggctggtgtggttcttcctaaaaccaagagcaacagctcaggttggattgtg
attactatggggtgggggattgcagttgcggttgcagtatttgtatctggcaagctcagt
ccagctcatttaaacccagctgtgaccatcggtgtggccttgaaaggtggtttgccttgg
gcttccgttttcccttatatattagcccagttcgcaggggctatgctgggtcagattttg
gtttggttgcaattcaaaccgcattatgaggcagaagaaaatgcaggcaatatcctggca
accttcagcactggtccagctatcaaggatactgtatcaaacttgattagcgaaatcctt
ggaacttttgtattggtcttgacaatctttgctttgggtctttacgattttcaggcaggt
atcggaacctttgcagtgggcactttgattgtcggtatcggtctatcactaggtgggaca
acaggatatgccttgaacccagctcgtgaccttggacctcgtatcatgcacagcatcttg
ccaattccaaacaagggagacggagactggtcttacgcttggattcctgttgtaggacct
gttatcggagcagccttggccgtttttgtattctcgcttttctaa

DBGET integrated database retrieval system