KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_0117Help
Entry
SmuNN2025_0117    CDS       T01185                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00010  Glycolysis / Gluconeogenesis
smc00020  Citrate cycle (TCA cycle)
smc00620  Pyruvate metabolism
smc01100  Metabolic pathways
smc01110  Biosynthesis of secondary metabolites
smc01120  Microbial metabolism in diverse environments
smc01130  Biosynthesis of antibiotics
smc01200  Carbon metabolism
Module
smc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SmuNN2025_0117
   00020 Citrate cycle (TCA cycle)
    SmuNN2025_0117
   00620 Pyruvate metabolism
    SmuNN2025_0117
Enzymes [BR:smc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SmuNN2025_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 PLA2_B
Motif
Other DBs
NCBI-ProteinID: BAH87143
LinkDB All DBs
Position
138104..139471
Genome map
AA seq 455 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDEVKEGEILLEIMSDKTNMEIEAEDSGVLLKIV
KGNGQVVPVTEVIGYIGQAGEVLEIADVPASTVPKENSAAPAEKTKVMSSPTVAAAPQGK
VRATPAARKAARDLGVNLNQVSGTGAKGRVHKEDVESFKAAQPKATPLARKIAIDKGIDL
ASVSGTGFGGKIIKEDILNLFEAAQPVKDVSDPAKEAAALPEGVEVIKMSAMRKAVAKSM
VNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMEKTGFKVSFTDLIGLAVVKTLMKPEHR
YLNASLINDATEIELHQFVNLGIAVGLDEGLLVPVVHGADKMSLSDFVIASKDVIKKAQT
GKLKATEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIQTPTVVDGEIKIRPIM
ALCLTIDHRLVDGMNGAKFMVDLKKLMENPFTLLI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaaattattatgcctaaacttggtgttgatatgcaggaaggcgaaatcatc
gagtggaaaaaacaagaaggtgatgaggtcaaagaaggggagatcctccttgagattatg
tctgacaagaccaatatggaaatcgaagctgaggattcaggtgtcctgcttaagattgtt
aaaggaaatggtcaagttgttcctgtaactgaggtcattggttatattggtcaagcaggt
gaagttcttgaaatagctgatgttcctgcaagtacagttcctaaagaaaatagtgcagca
cctgctgaaaaaacaaaagtaatgtcttctccgacagttgcagcagcccctcaaggaaag
gttcgagcaacaccagcagctcgtaaggcggctcgtgatctaggagttaacctgaatcag
gtttcagggacaggcgctaaaggccgtgttcacaaggaagatgttgaaagctttaaagca
gctcagcctaaagcaacaccattagctaggaaaattgctatagataaaggtattgatcta
gccagtgtctcaggaacaggttttggcggcaaaattatcaaggaagatattttaaatctg
tttgaggcagctcagcctgttaaagatgtgtcagatcctgctaaagaagcagctgcctta
ccagagggtgttgaagtcattaagatgtctgccatgcgtaaggcagtggctaaaagcatg
gtcaattcttacctgacagctccaacttttactctcaattatgacattgacatgactgag
atgattgcgttgcgtaaaaagttaattgatcctatcatggaaaaaacaggttttaaagtt
agcttcacagatttgattggtctggcggtcgtaaaaaccttaatgaaaccagaacatcgt
tacctcaatgcttcgctcattaatgacgcgactgagattgaacttcatcaatttgttaac
cttggtatcgccgttggacttgatgaaggactgttagtacctgttgttcatggtgcagat
aagatgagcttgtcagattttgttatagcttcaaaggatgtcattaagaaagctcagacc
ggtaaattaaaagccactgaaatgtctggttcaaccttttccattacaaacttggggatg
tttggcactaagactttcaaccccattatcaatcagccaaattcggctattttgggtgta
ggagcaactatccaaacgccaactgttgtggatggtgaaattaagattcgtccaatcatg
gcactgtgcttgaccatcgatcaccgcttggttgatggcatgaacggcgctaagttcatg
gttgatcttaaaaaactgatggaaaatccatttacattattgatttga

DBGET integrated database retrieval system