KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_0309Help
Entry
SmuNN2025_0309    CDS       T01185                                 

Gene name
yfbQ
Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00220  Arginine biosynthesis
smc00250  Alanine, aspartate and glutamate metabolism
smc00290  Valine, leucine and isoleucine biosynthesis
smc01100  Metabolic pathways
smc01110  Biosynthesis of secondary metabolites
smc01130  Biosynthesis of antibiotics
smc01210  2-Oxocarboxylic acid metabolism
smc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SmuNN2025_0309 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    SmuNN2025_0309 (yfbQ)
   00220 Arginine biosynthesis
    SmuNN2025_0309 (yfbQ)
Enzymes [BR:smc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SmuNN2025_0309 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     SmuNN2025_0309 (yfbQ)
Amino acid related enzymes [BR:smc01007]
 Aminotransferase (transaminase)
  Class I
   SmuNN2025_0309 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAH87335
LinkDB All DBs
Position
336163..337377
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSAKLEHVAYDIRGPVLEEADRMIANGEKILRLNTGNPAAFGLTAPDEVIRDLIM
NARESEGYSDSKGIFSARKAIMQYCQLKNIPDVDVDDIYIGNGVSEMITMSMQGLLDDGD
EVLVPMPDYPLWTAAVSLAGGQAVHYVCDENSNWYPDIDNIKSKITSNTKALVVINPNNP
TGALYPKDVLEDIVEVARQNDLIIFADEIYDRLVMDGGEHVAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKKHVKDYIEGLNMLSNMRLCSNVLAQQVIQTSLGGVQSIDELL
LPGGRIYEQRNFIYKAMNEIPGITAVKPQAGLYIFPKIDRNMYRIDDDEQFVLNFLKQEK
ILLVHGRGFNWMEPDHFRIVYLPRVEELSKIQEKMTRFLGQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataagtctgctaaacttgaacatgtggcctatgatattcgcggtcca
gtattagaagaagccgatcgtatgattgctaatggggagaaaatcttacgtcttaataca
ggaaatcctgccgcttttggattaacagcacctgatgaggttattcgggatttaattatg
aatgcgcgtgagagcgaaggttattcagattcgaagggaatcttttcagctcgtaaagct
attatgcaatattgtcagcttaaaaatattcctgatgttgatgttgatgacatctatatt
ggcaatggtgtatcggaaatgattactatgtctatgcaaggacttttagatgacggtgac
gaagttttagtccccatgcctgattatccactgtggacggctgctgttagtctggcagga
ggtcaggctgttcattatgtctgtgatgaaaattccaattggtatccagatattgataat
attaagtctaaaatcacttcaaatacgaaagctcttgtggttatcaatcctaataaccct
acaggggctctttatcccaaagatgtattagaagatatcgttgaagttgctcgtcagaat
gatttaattatttttgctgatgagatttatgatcgtctggtcatggatggtggggaacat
gtggctattgccagtcttgcaccggatcttttttgtgtttctatgaatggtttgtcaaaa
tcccatcgtattgcaggtttccgtgtaggttggatggttttatctgggcctaaaaaacat
gtcaaagattatattgaaggccttaacatgctttcaaatatgcgcctttgttctaatgtt
ctggctcaacaagttattcaaacatctttgggcggcgttcagtctattgatgaacttctt
ttgccgggtggccgtatttatgaacagcgtaattttatttataaagctatgaatgaaatc
cctggaatcacagcggtaaaacctcaggcgggactttatattttccccaaaattgaccgt
aatatgtatcggattgatgatgatgagcaatttgttctgaattttctcaaacaggaaaaa
atccttcttgttcatggacgcggctttaactggatggaaccagatcatttccgtattgtt
tatttaccgcgtgttgaagagctctctaagattcaagaaaagatgacacgcttcctaggg
caatatcggaaataa

DBGET integrated database retrieval system