KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_0504Help
Entry
SmuNN2025_0504    CDS       T01185                                 

Definition
(GenBank) putative permease
Organism
smc  Streptococcus mutans NN2025 (serotype c)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 TRI12 DUF4813
Motif
Other DBs
NCBI-ProteinID: BAH87530
LinkDB All DBs
Position
524027..525196
Genome map
AA seq 389 aa AA seqDB search
MIAWFGSFFTGASFSLVMPFMALFVEELGVKGDLVKLYAGLAVSISALASALFAPVWGRL
ADRYGRKPMMIRASLVMTFTMGGLAFVTDVYGLLFLRLLNGMFAGYVPNANALIASQAPK
NESGSALGTLATGVIAGSLIGPLMGGMLAEFLGIRNVFLLVGTLLLLVMLLTTFFIQEDF
RPVSKKDILSTKELFAQIKDRQILLGLFVTSMIIQISAQSVAPILALYIRYLGQRDNLML
IAGLIVSAMGFSSIISSSRFGKLGDKIGNHRMLLAGLFYCGIIYLILAQSKTPLQLGIWR
FLFGFGTGALMPSVNALLTKLTPKEGISRIFSYNQMFTNFGQVLGPFVGSTVAAGWGYRW
VFYATGAIVLFNFIWSLVNFRKYLKVREI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgatagcttggttcggtagcttttttactggagcaagcttttcacttgtcatgcctttt
atggctttatttgttgaggaattaggcgtaaaaggtgacttggtcaagctttatgcaggc
cttgcagtatcaatttcagccttagcttctgctctttttgcacctgtttggggacgtttg
gcagaccgttatggacgcaagcccatgatgattcgagctagtcttgtcatgacttttacc
atgggcggtctagcttttgtgacggatgtctatgggctgctttttttacgtttgcttaat
gggatgtttgcgggttatgtgccaaatgccaatgcacttattgcttctcaggctcctaaa
aatgaatcaggttctgctcttggaactttggctactggtgttattgctggcagtctaatt
ggtcctcttatgggcggtatgcttgctgaatttttaggtattcgcaatgtctttctcttg
gttggcactttgcttttattggtaatgctgctgacaactttttttattcaggaagatttc
cgacctgtatctaagaaagatatcttatctactaaagaactctttgctcaaattaaagat
cggcaaatactattggggctttttgttaccagtatgattattcaaatttcagctcagtct
gttgcccctattctggcactttatattagatatctagggcaaagggacaatctgatgtta
attgcgggcttaattgtgtctgctatgggcttttccagcattatttccagttcaagattt
gggaaattaggtgataaaattggcaatcaccgtatgttattagcaggtcttttttattgt
ggtattatttatttgattcttgctcagtcaaaaacacctctgcaattaggaatttggcgc
tttctttttggttttggtactggagccctcatgccaagtgttaatgctctattaacaaaa
ctaacacctaaggaaggtatctctagaatctttagctacaatcagatgtttaccaacttt
ggtcaggtattgggtccttttgtaggatcgactgtagcagcaggctggggttatcgctgg
gtcttttatgctacaggagcaattgttcttttcaattttatatggagtcttgttaatttt
agaaaatatttgaaagttagggaaatttag

DBGET integrated database retrieval system