KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_0522Help
Entry
SmuNN2025_0522    CDS       T01185                                 

Gene name
amyA
Definition
(GenBank) intracellular alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00500  Starch and sucrose metabolism
smc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SmuNN2025_0522 (amyA)
Enzymes [BR:smc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SmuNN2025_0522 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: BAH87548
LinkDB All DBs
Position
543183..544643
Genome map
AA seq 486 aa AA seqDB search
MTNETMMQYFEWYLSNDGKHWQHLAEDASHLKNIGISKVWMPPAFKGTGSNDVGYGVYDL
YDLGEFNQNGTVRTKYGSREDYLNAVNALKEQEIMPISDIVLNHKANGDAKERFQVVKVN
PSNRQEKISEPYEIEGWTQFNFPGRQDNYSDFKWHWYHFTGVDYDALHNENGIYMILGDN
KGWASQENIDQENGNYDYLMYDDIDFKHPEVQEHLRDWVAWFLETSGVGGFRLDAIKHID
KTFMAQFIRYIREHLKADLYVFGEYWKDSHFDITDYLHSVDLQFDLIDVMLHMNFFEAGQ
KGSDFDLSTILDDSLMKSHPDFAVTFVDNHDSQKGQALESTVAEWFKPLAYGLILLRQEG
IPCVFYGDYYGISGEFAQESFQTVLDKLLYIRQYHVYGPQEDYFDYANCIGWTCLGDEEH
PDGVAVIMSNGEANCKRMNMGEFNRNKVFVDYLNNCTEEVILDDQGWGDFPVQEASLSAW
VNKDAH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaacaatgatgcagtattttgaatggtacttgtcaaacgatggtaagcat
tggcagcatttagctgaagatgccagtcatcttaagaatattgggattagcaaagtttgg
atgccaccggcttttaaaggaacgggttccaatgatgttggctatggcgtttatgatctt
tatgatctgggtgaatttaatcaaaatggaactgtcaggaccaagtatggcagcagggaa
gattatctcaatgctgtgaatgctctgaaggagcaggaaatcatgcctatttccgatatt
gtccttaatcacaaggccaatggtgatgccaaagaaagatttcaagtggttaaagtcaat
cccagcaaccgtcaagaaaagatttctgaaccttatgagattgaaggttggacccagttt
aactttccgggccgacaggataactacagcgatttcaaatggcattggtaccatttcact
ggcgttgattatgacgctcttcataatgaaaatggtatctacatgatcctaggtgataac
aagggttgggccagtcaggaaaatattgatcaggaaaatggtaattatgattacctgatg
tatgatgatattgattttaaacatcctgaagtacaggagcacttgcgagattgggttgct
tggtttttggaaacaagtggtgtcggtggttttcgtttagatgctattaaacatattgat
aagacttttatggcacaatttattcgttatattcgtgagcatcttaaagcagacctttat
gtttttggtgagtactggaaagacagtcatttcgatattaccgattatcttcatagtgtt
gacctgcaatttgacctgattgatgttatgctacatatgaatttctttgaggctggtcaa
aaaggttctgattttgatttgtcaacgattttagacgatagtctgatgaaaagccatcct
gattttgctgttacttttgttgataatcatgattcccaaaaagggcaggctttagagtca
acggttgcagagtggtttaaacctttagcttatggtttgattttgttgcgtcaagagggg
attccttgtgtcttttacggtgattactatggtatttcgggtgaatttgctcaggaatct
ttccagactgttttagataaactgctttatatcaggcaataccatgtttatggaccgcaa
gaagattattttgactatgccaattgtattggctggacttgtctgggagatgaagagcac
cctgatggtgtagctgttatcatgtctaatggggaagccaattgcaaacgtatgaatatg
ggagaatttaatcggaataaggtttttgttgattatcttaataattgtacagaagaagtg
attttagatgatcaaggctggggtgattttccagttcaagaagcttccttgtcagcttgg
gttaataaagatgctcattga

DBGET integrated database retrieval system