KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_1692Help
Entry
SmuNN2025_1692    CDS       T01185                                 

Definition
(GenBank) putative hexulose-6-phosphate synthase
  KO
K03078  3-dehydro-L-gulonate-6-phosphate decarboxylase [EC:4.1.1.85]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00040  Pentose and glucuronate interconversions
smc00053  Ascorbate and aldarate metabolism
smc01100  Metabolic pathways
smc01120  Microbial metabolism in diverse environments
Module
smc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:smc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SmuNN2025_1692
   00053 Ascorbate and aldarate metabolism
    SmuNN2025_1692
Enzymes [BR:smc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.85  3-dehydro-L-gulonate-6-phosphate decarboxylase
     SmuNN2025_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-ProteinID: BAH88718
LinkDB All DBs
Structure
PDB: 

Position
complement(1788921..1789586)
Genome map
AA seq 221 aa AA seqDB search
MTKQLPNLQVALDHSNLKGAITAAVSVGNEVDVIEAGTVCLLQVGSELVEVLRSLFPAKI
IVADTKCADAGGTVAKNNAVRGADWMTCICSATIPTMKAARKAIEDINPDKGEIQVELYG
DWTYDQAQQWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKKLIEMGFRVSVTGGLSVD
TLKLFEGVDVFTFIAGRGITEAKNPAGAARAFKDEIKRIWG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaattgccaaatttacaggttgcactggaccattctaacttgaaaggcgct
attacagcagcggtttctgtaggaaatgaagtagatgttatagaagcaggaaccgtctgt
ctccttcaagttggcagcgaattggtagaagtcttacgcagtctttttccagctaaaatc
atcgttgccgatacaaagtgtgctgatgctggcggtacagttgctaaaaataatgctgtg
cgtggcgctgactggatgacctgtatctgttcagctactattccaaccatgaaagcagcc
cgtaaagctattgaagacattaatcctgataaaggtgagattcaggttgaactctatggt
gattggacctatgatcaggctcaacagtggttagatgccggtatttcacaagcgatctat
caccaatcacgcgatgctctgcttgcaggtgaaacttggggagaaaaagaccttaacaag
gttaaaaaacttattgaaatgggttttcgtgtttcagtaaccggtggtcttagtgttgac
accttgaaactctttgaaggagttgatgttttcacctttatcgcaggacgtgggatcact
gaggcgaaaaatcctgctggggcagcacgtgcatttaaagacgaaatcaaacggatctgg
gggtag

DBGET integrated database retrieval system