KEGG   Sinorhizobium medicae: Smed_0512Help
Entry
Smed_0512         CDS       T00555                                 

Definition
(RefSeq) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
smd  Sinorhizobium medicae
Pathway
smd00061  Fatty acid biosynthesis
smd00780  Biotin metabolism
smd01100  Metabolic pathways
smd01130  Biosynthesis of antibiotics
smd01212  Fatty acid metabolism
Module
smd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Smed_0512
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Smed_0512
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Smed_0512
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:smd01004]
    Smed_0512
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Smed_0512
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Smed_0512
Lipid biosynthesis proteins [BR:smd01004]
 Fatty acid synthase
  Component type
   Smed_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 5321346
NCBI-ProteinID: YP_001326203
UniProt: A6U6T8
LinkDB All DBs
Position
556171..556989
Genome map
AA seq 272 aa AA seqDB search
MAQASGLMNGKRGVIMGVANNRSIAWGIAKALSEAGAEIALTWQGDALKKRVEPLAQELG
AFMAGHCDVTDLTTIDAVFSALEEKWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFARTM
DISVYSFTAVAARADRIMNDGGSILTLTYYGAEKVMPHYNVMGVAKAALEASVRYLAVDL
GNRGIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLKRTVSIEEVGNSALYLLSDLS
SGVTGEVHHVDSGYHTVGMKAVDAPDISVLKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcatcgggtctgatgaatggcaagcgtggcgtcattatgggcgtcgcaaac
aatcgctcgatcgcgtggggcatcgccaaggccttgtccgaggccggggccgagatcgca
ttgacgtggcagggggacgctctgaaaaagcgcgtcgagccgcttgcacaggagcttggt
gccttcatggccggccattgcgacgtgaccgacctcaccacgatcgatgccgtattctcg
gccctcgaagagaaatggggcaagatcgacttcgtcgtgcatgcgattgctttctcggac
aaggacgagttgacgggacgctacctggatacgagccgcgataacttcgcgcgaacgatg
gatatctccgtttactccttcacggcggtcgcggcgcgggcggatcgcatcatgaatgat
ggcggttcgatcctgacgctgacctattacggtgccgagaaggtgatgccgcactataat
gtcatgggtgtcgccaaggccgccctggaggcaagcgttcgttatctggcggtcgatctc
ggcaatcgcggtatccgtgtcaacgcgatctccgccggccccatcaagacgcttgcggcc
tccggcatcggtgatttccgctatatcctgaagtggaacgaatacaacgcaccgctgaag
cggacggtctcgatcgaggaggtcggcaattccgcactctacctgctttccgatctgtcg
agcggtgtgaccggcgaagtccatcatgtcgattcgggctatcacaccgttggaatgaag
gccgtcgacgcgccggacatcagcgtactcaaggactga

DBGET integrated database retrieval system