KEGG   Sinorhizobium medicae: Smed_0587Help
Entry
Smed_0587         CDS       T00555                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smd  Sinorhizobium medicae
Brite
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Smed_0587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 5321423
NCBI-ProteinID: YP_001326278
UniProt: A6U713
LinkDB All DBs
Position
635936..636538
Genome map
AA seq 200 aa AA seqDB search
MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS
YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFVAAGT
GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDNLINWDYVLELYEAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgaaccttccctatgactacgatgcgctcgcaccctatatgtcg
cgcgaaacgctcgaataccatcacgacaagcaccacctcgcttacgtgacgaacggcaac
aagctcgccgaggaagccggtctttccgatctttcgctggaagatatcgtcaagaaatcc
tacggcaccaaccagccgttgttcaacaatgccggccagcactacaaccatgtccacttc
tggaagtggatgaaaaagggtggcggcggcaccagtcttcccggcaagcttgacgccgcg
atcaagtcggaccttggcggctacgacaagttccgcgccgattttgttgctgccggtacg
ggccagttcggctccggctgggcctggctttcggtaaagaacggcaagctggaaatctcc
aagaccccgaacggcgaaaatccgctggtacacggcgcaaccccgatcctgggcgtcgat
gtgtgggaacattcctattacatcgactatcgcaacgcgcgcccgaaatacctcgaagcc
ttcgtcgacaatctcatcaactgggattacgtcctcgaactgtacgaagcggctgcaaag
taa

DBGET integrated database retrieval system