KEGG   Sinorhizobium medicae: Smed_1078Help
Entry
Smed_1078         CDS       T00555                                 

Definition
(RefSeq) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smd  Sinorhizobium medicae
Pathway
smd00010  Glycolysis / Gluconeogenesis
smd00020  Citrate cycle (TCA cycle)
smd00620  Pyruvate metabolism
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
smd01130  Biosynthesis of antibiotics
smd01200  Carbon metabolism
Module
smd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smed_1078
   00020 Citrate cycle (TCA cycle)
    Smed_1078
   00620 Pyruvate metabolism
    Smed_1078
Enzymes [BR:smd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Smed_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N DUF2118 QRPTase_N HlyD_2 Peptidase_M23 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-GeneID: 5321924
NCBI-ProteinID: YP_001326765
UniProt: A6U8F0
LinkDB All DBs
Position
1146958..1148331
Genome map
AA seq 457 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAADGEDVATAAKGGNGAAGETAATKPQETAEAAPAAAKAPAEA
KAPAEANAPQADAPAPQAASPTPAAGDGKRIFSSPLARRLAREAGIDLSAIAGSGPHGRV
IKKDVEAAASGGAAKTAAAPAAAPAPSAPAKGMSEDAVLKLFEPGSYELVPHDGMRKTIA
KRLVESKQTIPHFYVSVDCELDALLALRAQLNSAAPEKDGKSVYKLSVNDMVIKALALAL
RDVPDANVSWTDQNMVKHKHADVGVAVSIPGGLITPIIRQAELKSLSAISNEMKDLGKRA
KERKLKPEEYQGGTTAVSNMGMMGVKNFAAVVNPPHATILAVGAGEERVVVKNKETVIAN
VMTVTLSTDHRCVDGALGAELLAAFKRYIESPMGMLV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggccctctctccgacgatggaagaaggcaatctcgcc
aagtggctggtcaaggaaggcgataaggtcaaatccggcgacgtgatcgccgagatcgag
accgacaaggcgacgatggaagtggaagccgtcgatgagggcacggtcgccaaaatcgtc
gttcccgccggaaccgaaggcgtcaaggtcaatgcgttgatcgcggttctcgccgctgat
ggcgaggacgttgccaccgctgccaagggtggcaacggggcggcgggagaaaccgccgca
acgaagccgcaggaaacggcggaagcagcacccgccgcggcaaaggcgcccgcggaagca
aaggcacccgccgaagcgaacgccccgcaggcggacgcaccggcaccgcaagcagcctcg
cccacaccggccgcaggcgacgggaagcggatcttttcttcgccgctggcgcgccgcctc
gccagggaggcgggtatcgacctgtcggcaatcgccgggtccgggccgcatggccgcgtc
atcaagaaggatgtcgaggccgccgcttccggcggtgccgccaagaccgccgctgctccg
gcagcagctccggccccgtcggcgcctgccaagggcatgtcggaagatgcggtgttgaag
ctcttcgagccaggctcctacgagctcgtgccgcatgacggcatgcgcaagacgatcgcc
aagcgcctcgtcgaatcgaagcagacgatcccgcatttctacgtctcggtcgattgtgaa
ctcgacgcgttgctggcactgcgcgcccagctgaattccgcagcacctgaaaaagacggt
aagtcggtctacaagctttccgtcaacgacatggtgatcaaggcgttggccctggcgctg
cgtgacgtcccggatgcgaatgtctcctggacggatcagaacatggtcaagcacaagcac
gcggatgtcggcgttgccgtctccattcccggcggcctgatcacccccatcatccgccag
gcggaattgaaaagcctctcggcgatttccaacgagatgaaggacctcggcaagcgggcg
aaagagcgcaagctcaagccggaagaatatcagggcggcaccacggccgtctccaatatg
ggcatgatgggcgtcaagaacttcgcagcagtcgtcaatccgccgcacgcgacgatcctc
gcggtcggtgccggcgaggaacgcgtcgtcgtcaagaacaaggagacggtcatcgccaat
gtgatgaccgtgacgctttcgacggatcatcgctgcgtggacggggcattgggcgccgaa
ctgctcgccgccttcaagcgctacatcgaaagcccgatgggcatgctcgtctga

DBGET integrated database retrieval system