KEGG   Sinorhizobium medicae: Smed_1740Help
Entry
Smed_1740         CDS       T00555                                 

Definition
(RefSeq) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA/FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
smd  Sinorhizobium medicae
Pathway
smd00061  Fatty acid biosynthesis
smd00780  Biotin metabolism
smd01100  Metabolic pathways
smd01212  Fatty acid metabolism
Module
smd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Smed_1740
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Smed_1740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:smd01004]
    Smed_1740
Enzymes [BR:smd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Smed_1740
Lipid biosynthesis proteins [BR:smd01004]
 Fatty acid synthase
  Component type
   Smed_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-GeneID: 5322598
NCBI-ProteinID: YP_001327410
UniProt: A6UA95
LinkDB All DBs
Position
complement(1820555..1821031)
Genome map
AA seq 158 aa AA seqDB search
MLLEYFQMIDRIESVDLAAGRLVARSNVPEKSPVFEGHFPGYPLVPGVLLIETMAQASGF
LVLAATNFAAMPFLMTVDGAKMRSFVEPNAELEIEALLEHEGSGFAVTKARIASGGKKIC
DAKLKLRTIPFDQVPLGDIVRKRAEELGLMARTAGSEK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgctccttgaatatttccagatgattgaccggatcgaaagcgtcgatctggcagccggc
cgtctggtggcgcgctcgaacgtgccggaaaagagcccggtgttcgaagggcatttcccc
ggctatcccctggtccccggcgtgctgcttatcgaaacgatggcgcaggcatccggtttt
ttggtgctggccgccaccaatttcgccgcaatgccgtttctgatgacagtcgatggtgcg
aagatgcgcagcttcgtcgaaccgaacgccgagcttgagatagaggccctgctcgagcac
gaggggtccggctttgccgtgacgaaggcccggattgcgtcgggcggcaagaagatttgc
gatgccaagctgaaactgagaacgattccgttcgaccaggtgccgctcggcgacatcgtg
cgcaagcgtgcggaagagctggggctgatggccaggacggccggttcggagaaatga

DBGET integrated database retrieval system