KEGG   Sinorhizobium medicae: Smed_2903Help
Entry
Smed_2903         CDS       T00555                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smd  Sinorhizobium medicae
Pathway
smd00564  Glycerophospholipid metabolism
smd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Smed_2903 (glpD)
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Smed_2903 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 NAD_binding_8 FAD_oxidored FAD_binding_3 FAD_binding_2 GIDA 3HCDH_N STPPase_N
Motif
Other DBs
NCBI-GeneID: 5323780
NCBI-ProteinID: YP_001328568
UniProt: A6UDK3
LinkDB All DBs
Position
3046392..3047903
Genome map
AA seq 503 aa AA seqDB search
MSEQAIFDVFVIGGGINGCGIARDAAGRGYSVALAEMNDFASGTSSGSTKLIHGGLRYLE
YYEFRLVREALMEREVLWAMAPHVIWPMRFVLPFHKGGPRPAWLIRLGLFLYDHIGGRKR
LPATSTLDLTRDPAGVPLKRLFSKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARRASGRWTIEIEDVTTGARETLGARMLVNAAGPWVDRILSEAVGKKDVRNVRLVQGSH
IVLTKKFDDTRAYFFQNPDGRIMFAIPYQNDFTLIGTTDHDFAGNPADVRISDAEIDYLC
AAASEYFKDPVTRDDIVWTYSAVRPLYDDGASKAQEATRDYVLRVENGDAPLLNVFGGKL
TTYRRLAESALDKIGEAIGAKGGKWTAGSHLPGGDFPATGYEDEVEKLKSRYPFLAASHV
RRLVRLYGRLAAQLLGNAASEADLGRYFGADLYAAEVDWLIGREWALGAEDVLWRRTKLG
LKFSRAQIAELEEYIRAAANAAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcaggcgatcttcgacgtcttcgtcataggcggcggcatcaacggatgcggc
attgcgcgtgatgcggccggtcggggatattccgtcgcgcttgcggagatgaacgatttc
gcctcgggaacgtcttccggctcgaccaagctcatccatggcggcctgcgctatctcgaa
tattatgagttccgcctcgtacgcgaagccttgatggagcgcgaagtcctctgggcgatg
gcgccgcatgtcatttggccgatgcggttcgttctgcctttccacaagggcggcccacgg
cccgcctggctgatccgtctcggcctcttcctctacgaccatattggcggccgcaagcgc
ctgccggcgacaagcactcttgacttgacccgggatccggccggcgtgcccttgaagcgc
ctcttctccaaggctttcgaatattcggatgggtgggtcgacgatgcccgcctcgtggtc
ttgaacgcacgcgatgccgccgatcgcggcgcgcggatcatggcccgtacccgcgtcgtc
tcagcacggcgcgcatccggacgttggacgatagagatcgaggatgtcacgacgggagcg
cgcgagacgctgggcgcccgcatgctcgtcaatgccgcaggtccctgggtggaccggatt
ctctccgaagccgtcggaaagaaggacgtccgcaatgtccgcctcgtccagggcagccat
atcgtcttaacgaaaaagttcgacgatacgcgggcctatttcttccagaacccggacggg
cggatcatgttcgccattccctaccagaacgatttcacactcatcggaacgacagatcac
gattttgccggcaatccggcggatgtgcgcatcagtgacgcagaaatcgactatctctgc
gcggcggcgagcgaatatttcaaagatccggtcacgagggacgatatcgtctggacctat
tccgccgttcgtcccctttacgacgacggcgcgagtaaagcccaggaagcgacccgcgac
tatgtgctgcgcgtcgagaacggcgatgcgccgctgctcaatgtcttcggcggcaagctc
accacctaccggcggcttgcggaatcggctctggacaagatcggcgaggctattggcgcc
aagggcgggaaatggaccgccggatcgcatcttcccggcggcgacttcccggcgacaggc
tatgaagacgaggtggaaaagctcaagtcgcgctatccgtttctggctgcctcgcatgtc
cgccggctggtgcggctctatgggaggcttgcggcgcagcttctcggcaacgccgcaagc
gaggccgatcttggaaggtacttcggagcggatctctacgcggcggaggtggattggctc
atcggacgggaatgggcgttgggcgcggaagacgtgctttggcgccgaacgaaactggga
ctgaagttttcgcgggcgcaaatcgcggaactggaggaatatatccgggcagcggccaac
gccgccgcctga

DBGET integrated database retrieval system