KEGG   Sinorhizobium medicae: Smed_2996Help
Entry
Smed_2996         CDS       T00555                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smd  Sinorhizobium medicae
Pathway
smd00010  Glycolysis / Gluconeogenesis
smd00071  Fatty acid degradation
smd00350  Tyrosine metabolism
smd00625  Chloroalkane and chloroalkene degradation
smd00626  Naphthalene degradation
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
smd01130  Biosynthesis of antibiotics
smd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smed_2996
  Lipid metabolism
   00071 Fatty acid degradation
    Smed_2996
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smed_2996
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smed_2996
   00626 Naphthalene degradation
    Smed_2996
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smed_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short Methyltransf_25 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 5323873
NCBI-ProteinID: YP_001328660
UniProt: A6UDU5
LinkDB All DBs
Position
complement(3147005..3148039)
Genome map
AA seq 344 aa AA seqDB search
MKMAQTMKAAVVRQFRAPLTIEEMEVPTPGAGQVLVKYEATGVCHTDLHAANGDWPVKPA
PPFIPGHEGVGFVSAVGAGVRRVKEGDRVGVPWLHTACRYCTYCRTGWETLCSSQSNTGY
SVNGTFAEFGLADPEFAGKIPDRLEFGAAAPVLCAGVTVYKGLKETEVRPGEWVAISGVG
GLGHMAVQYAKAMGMHVVAADISEDKLALAKQLGADIAVNGKSDDAVEQVQKATSGGVHG
VLVTAVSPAAMEQAFGFLRSKGTMVLVGLPPGMMSLPVFETVLKRITVRGSIVGTRQDLE
ESLAFAAEGKVKPYFSWESLENINDIFHRMEAGKIDGRIVVRLQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggcacagacgatgaaggcggctgtcgtacgccagttccgcgctccgctgacc
atagaggagatggaagtcccaacgcctggcgccgggcaggtcctcgtaaaatatgaagca
acgggcgtgtgccataccgatctgcatgcggcaaacggcgattggcccgttaagccggct
ccgccctttattccagggcacgagggtgttggcttcgtctcggccgtgggcgccggcgtg
aggagagtgaaagaaggtgacagggttggggtgccatggctccacaccgcttgccgttac
tgtacctattgccggaccggttgggaaacgctgtgctcttcgcaatcgaacaccgggtac
tcggtgaacggcaccttcgcggagttcggactggcagatcccgagttcgcgggaaagatt
cctgatcggttggaattcggagccgccgcgcccgttctctgcgcgggagtgaccgtctac
aaggggctgaaggaaacggaagtccgtcccggtgaatgggtggccatctcgggcgtcggc
ggtctcggccacatggcggtgcaatatgccaaggcaatgggaatgcacgtggtggccgcc
gacatatccgaagacaagctggcgctggccaagcaacttggcgccgacatcgcagtaaac
ggcaagtcggacgatgcagtcgagcaggtacagaaggccacgagcggcggcgttcacgga
gtgctcgtgaccgctgtctctcccgccgccatggaacaggcctttggtttcctgcggtcg
aaaggcacgatggtcttggtcggtcttccccccggaatgatgtccttgccggttttcgag
accgtcctgaaacgcataaccgtgcgtggatcaatcgtgggtacccgacaagacctcgag
gaatcgctcgctttcgcggcggaaggcaaggtaaagccgtatttctcgtgggagagcctc
gagaacatcaacgacatcttccatcgcatggaagcgggcaagatcgacggtcgaatagtg
gtgcgattacagtag

DBGET integrated database retrieval system