KEGG   Sinorhizobium medicae: Smed_4677Help
Entry
Smed_4677         CDS       T00555                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smd  Sinorhizobium medicae
Pathway
smd00250  Alanine, aspartate and glutamate metabolism
smd00410  beta-Alanine metabolism
smd00640  Propanoate metabolism
smd00650  Butanoate metabolism
smd01100  Metabolic pathways
smd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Smed_4677
   00650 Butanoate metabolism
    Smed_4677
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Smed_4677
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Smed_4677
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smd01007]
    Smed_4677
Enzymes [BR:smd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Smed_4677
Amino acid related enzymes [BR:smd01007]
 Aminotransferase (transaminase)
  Class III
   Smed_4677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 5318134
NCBI-ProteinID: YP_001313407
UniProt: A6UIJ4
LinkDB All DBs
Position
pSMED01:complement(1191216..1192484)
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQIYAERAENAEIWDKEGNRYIDFASGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNAIVPGDFAKKTIFVTTGAEAVENAVKIAR
AATGRQAIVAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPVELHGVSVEQS
LAALKKLFAADVDPNRVAAIIIEPVQGEGGFYPVPTAFMKALREICDQNGILLIADEVQT
GFARTGKLLAMEHHGVAPDLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPL
GIAAAHAVLDVIAEENLCERANQLGNRLKQRLAAIREKAPEIVDIRGPGFMNAVEFNDVK
TNVPSAEFANKVRLLALEKGLILLTCGVHGNVIRFLAPITIQDDVFAEALDILESSILEA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccttaccgatcgcaagaatgcagctatttcccgcggtgtcggcatgaccacg
cagatctacgccgagcgcgcggaaaatgccgaaatctgggacaaggaaggcaaccgctac
atcgactttgcctcggggatcgccgtggtaaatacgggccaccgccacccaaaggtgatc
gccgccgtcaaggcgcagctcgaccgcttcacccatacctgccaccaggtcgtgccctac
gaaaactacgtgcatctggccgaacgcctgaacgcgatcgtgcccggcgacttcgcgaag
aagacgattttcgttacgaccggtgccgaggctgtcgaaaacgccgtcaagatcgcgcgc
gccgcgaccggccgccaggcgatcgtcgccttcggcggcggtttccatggccgcactttc
atgggcatggcgctgaccggcaaggtcgttccatataaggtcggcttcggcgcgatgccg
gcggatgtgttccacgctcccttcccggtcgagcttcatggcgtcagcgtcgagcagtcg
ttggcggcgctgaagaagctcttcgctgctgacgtcgatccgaaccgcgtcgctgcgatc
atcatcgagccggttcagggcgaaggcggcttctatccggttccgaccgccttcatgaag
gcgctgcgcgagatctgcgatcagaacggcatcctgctgatcgccgacgaggtccagacc
ggttttgcccggaccggcaagctgcttgccatggaacatcatggcgtcgcaccggacctg
acgacaatggcgaagagcctcgccggcggtttcccgctcgccgccgtgactggccgcgcc
gagatcatggacgcgcccgggccgggcggcctgggcggcacctacggcggcaatccgctc
ggcatcgccgccgcgcatgccgtgctcgacgtgattgccgaggaaaatctatgcgaacgg
gcgaaccagctcggcaaccggctgaagcagcgccttgcggcaatccgtgagaaggcgccg
gagatcgtggatatccgcggacccggcttcatgaacgctgtcgaattcaacgatgtgaag
acgaacgtccctagcgccgaattcgccaataaggtccgcctccttgccctggaaaagggg
ctcatcctcttgacctgtggcgtacacggcaatgtcatccgctttctggcgccgatcacg
atccaggatgatgtcttcgcggaagccctggacatcctcgaatcctcgatcctcgaagcg
cgcggttga

DBGET integrated database retrieval system