KEGG   Sinorhizobium meliloti 1021: SM_b20198Help
Entry
SM_b20198         CDS       T00058                                 

Gene name
rbcL
Definition
(RefSeq) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00630  Glyoxylate and dicarboxylate metabolism
sme00710  Carbon fixation in photosynthetic organisms
sme01100  Metabolic pathways
sme01120  Microbial metabolism in diverse environments
sme01200  Carbon metabolism
Module
sme_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SM_b20198 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SM_b20198 (rbcL)
Enzymes [BR:sme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SM_b20198 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 1236522
NCBI-ProteinID: NP_436731
RhizoBase: SM_b20198
UniProt: P58348
LinkDB All DBs
Position
pSymB:complement(205767..207227)
Genome map
AA seq 486 aa AA seqDB search
MNADAKTEIKGRERYKAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQDGVDPIEAAAAV
AGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLT
ASIIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGKPLLGATTKPK
LGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYCMEAVNHASAVTGEVKG
HYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIVGWTAIQSISEWCRQNDMILHMHRAGH
GTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPPTVQGYYNVCREMKNEVDL
PRGLFFEQDWADLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGAT
ANRVALEAMVLARNEGRDIAHEGPEILRAAAKWCKPLEAALDIWGNISFNYTPTDTSDFV
PSVTAA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgacgcaaagacagagatcaagggccgcgaacgttacaaggccggcgtgctg
aaatacgcccagatgggctactggaacggagactacgagccgaaggacaccgacctgatc
gcgctcttccggatcacgccgcaggacggcgtcgatccgatcgaagcggccgccgccgtt
gccggcgaaagctcgacggccacatggacggtcgtctggaccgatcgcctgacggcctgc
gatcaataccgcgccaaggcctaccgggtggatccggtgccgggaacgccggggcagtac
ttctgctatgtcgcctacgacctcatcctcttcgaggaagggtcgatcgcgaacctgacg
gcatcgatcatcggcaacgtcttctcgttcaagccgctgaaggcggcaaggctcgaggat
atgcgcctgcccgtcgcctacgtgaagaccttcaggggtccgccgaccggcatcgtcgtc
gagcgcgaacggctcgacaagttcggcaagccgctgctgggtgccacgaccaagccgaag
ctcggcttgtctggcaagaactatggccgcgtcgtctatgaggggctgaagggcggtctc
gacttcatgaaggacgacgagaacatcaattcgcagcccttcatgcattggcgcgaccgc
tacctctactgcatggaggccgtcaatcacgcttccgccgtcaccggcgaggtgaagggg
cactacctcaacatcactgccggcacgatggaggaaatgtaccggcgcgccgaattcgcc
aaggaactcggctcggtcatcgtcatggtcgatctcatcgtcggttggactgctatccag
tcaatatcggaatggtgccggcagaacgacatgatcctgcacatgcaccgggccggtcac
ggcacctatacgcggcagaagaaccacggcatctccttccgcgtgatcgccaaatggctg
cggctcgccggcgtcgaccacctgcatgcgggcacggccgtaggcaagctcgagggcgac
ccgccgacggtgcagggctactacaatgtctgccgcgaaatgaagaacgaggtcgacctt
ccgcgcggtctgttcttcgagcaggactgggcggacctcaagaaggtcatgcccgtcgcc
tcgggcggcatccatgccggtcagatgcaccagctgctcgatcttttcggcgacgatgtc
gtattgcagttcggcggcggcacgatcgggcatccgatgggcatccaggcaggggccacc
gccaatcgcgtcgccctggaagccatggtgcttgcccgcaacgagggccgcgacatcgcc
cacgaaggtcccgagatcctgcgggcggcggcgaagtggtgcaaaccgctggaagcggcc
ctcgatatctggggcaatatcagcttcaactacaccccgaccgatacgtcggatttcgtg
ccgagcgtaaccgcggcctga

DBGET integrated database retrieval system