KEGG   Sinorhizobium meliloti 1021: SM_b20219Help
Entry
SM_b20219         CDS       T00058                                 

Definition
(RefSeq) response regulator protein
  KO
K02483  two-component system, OmpR family, response regulator
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sme02022]
    SM_b20219
Two-component system [BR:sme02022]
 OmpR family
  Unclassified
   SM_b20219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 1236543
NCBI-ProteinID: NP_436752
RhizoBase: SM_b20219
UniProt: Q92WW5
LinkDB All DBs
Position
pSymB:complement(227578..228315)
Genome map
AA seq 245 aa AA seqDB search
MEHIDHILIVDDDREIRELVSAYLKKNGLRVTAVADGRQMRTFLEANTVDLIILDLMMPG
DDGLVLSRELRVGRHKATPIVMLTARSDEMDRIIGLEMGADDYIAKPFSARELLARIKAV
LRRARMLPANLQVSEAGQLLRFGQWKLDTTARHLIDADGTAIALSGAEYRLLRVFVDHPQ
RVLNRDQLLNLTQGREAELFDRSIDLLVSRVRQRLGDDAREPTYIRTVRSEGYVFSVPVE
IMEPR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatcgatcacatcctgatcgtcgatgacgatcgggaaatccgcgagcttgtg
tccgcttacctgaagaagaacggtctgcgggtgaccgccgttgccgacgggcggcagatg
cggaccttcctcgaggcaaatacagtcgatctgatcatcctcgatctgatgatgccgggc
gacgacggcctcgtcttgagccgcgagctgcgtgtcggcagacacaaggcgacgcccatc
gtcatgctgaccgcccgctcggacgagatggaccgcatcatcgggctggaaatgggcgcc
gacgactatatcgccaaacccttctcggcgcgcgaactgctcgcccgcatcaaggcggtc
ctgcggcgcgcgcggatgctgccagcgaacctgcaggtctcggaggcaggtcagctgttg
cgtttcggccaatggaagctggacacgacggcaaggcatctcatcgatgcggatggtact
gcgattgcactcagcggcgccgaataccggctgctgcgcgtcttcgtcgaccacccgcag
cgcgtcctcaaccgcgatcagctcctcaacctcacacaggggcgcgaggccgagctcttc
gaccgatcgatcgatctcctggtcagccgggtacgccagcgcctcggcgacgatgctcgg
gaaccgacctatatcaggaccgtccgcagcgaaggctatgttttctcggtgccggtcgag
atcatggagccccgctga

DBGET integrated database retrieval system