KEGG   Sinorhizobium meliloti 1021: SM_b20420Help
Entry
SM_b20420         CDS       T00058                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SM_b20420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SM_b20420
Enzymes [BR:sme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SM_b20420
Transporters [BR:sme02000]
 Other Transporters
  Pores ion channels [TC:1]
   SM_b20420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 Tom37 GST_N_4
Motif
Other DBs
NCBI-GeneID: 1236737
NCBI-ProteinID: NP_436946
RhizoBase: SM_b20420
UniProt: Q92WD5
LinkDB All DBs
Position
pSymB:433992..434618
Genome map
AA seq 208 aa AA seqDB search
MMKLYGLGPTRSLRARWALQELDAEFEFVAVNILAGEAHHPDFLRLNPAGKLPVLVDGDF
VLTESAAIVMYLAEKYGGKGLMPADLKERAQAYRWSLFAVTELEQPLWRMAKHTFLYPEE
KRLPEDIALAKEEFLAMAAVLEQHMKGREFIVGDRISIADCVTAYVLDWGNENGLLDDFP
NLRAYLERMYARPKAPQRIAEAFASLQS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactatatggattaggtccgacacgctcgcttcgcgcccgttgggcgcttcag
gagctggatgcggaattcgagttcgtggccgtcaacatactggcgggcgaggcccatcac
cccgacttcctgcggctcaatccggcgggcaagcttccggtgctggtcgatggcgacttc
gtcctcacggaatctgcggcgatcgtcatgtatctggcggaaaagtatggcggcaaaggg
cttatgccagcggacctgaaggagcgggcgcaggcgtatcgctggtctctgttcgcggtc
accgaactcgaacagccgctgtggcggatggcaaagcacacgtttctttatcccgaggaa
aagcggttgccggaagacattgcgctcgccaaggaagaattcctggccatggcagcggtg
ctcgaacagcacatgaaagggagggaattcatcgtcggcgacaggataagtatcgccgat
tgcgtaaccgcctatgttctggattggggcaatgaaaacggcctgctcgatgactttcca
aatcttagggcgtatctcgagcggatgtatgcgcgccccaaggcgccgcaacggatcgcg
gaggcatttgcgagccttcagagttag

DBGET integrated database retrieval system