KEGG   Sinorhizobium meliloti 1021: SMc00036Help
Entry
SMc00036          CDS       T00058                                 

Gene name
gst1
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SMc00036 (gst1)
Enzymes [BR:sme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SMc00036 (gst1)
Transporters [BR:sme02000]
 Other Transporters
  Pores ion channels [TC:1]
   SMc00036 (gst1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C Tom37 PEPCK_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 1232599
NCBI-ProteinID: NP_385062
RhizoBase: SMc00036
UniProt: Q92RD3
LinkDB All DBs
Position
1050794..1051414
Genome map
AA seq 206 aa AA seqDB search
MLKLFYTPGTCSLASHIALEEAGAGYEVHRVDFSKAEQTKPDYLTINPKGRVPALVTDRG
ILTETPAILAYIAQSFPKARLAPLDDPFEFARLQSFLSYLCSTVHVAHAHARRAARWADD
PAAQEAMKAKVPQNMADCFALIERTMFVGPFVRGDAYSVADPYLFTIAGWLESDGVDPAR
FPRILDHRNRMAERPAVAKVLAEVQS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgttttatacgcccggaacctgctcgcttgcctcgcacatcgcgttagag
gaagccggtgccggctatgaagtgcatcgggtcgatttttccaaagccgagcagaccaag
ccggactacctcaccatcaaccccaaggggcgggtgcccgccctcgtgaccgaccgtggt
atcctgaccgagacgccggccattctcgcctatatcgcccagagcttcccgaaggcgcgg
cttgcgccgcttgacgatcctttcgagttcgctcggctgcagtcgttcctgagctatctc
tgctcgacagtccacgtcgcccatgcccatgcccgtcgagccgcgcggtgggcagacgac
ccggcagcgcaggaggcgatgaaggccaaggtgccgcagaatatggccgactgcttcgcg
ctgatcgagcgcacgatgttcgtcggcccctttgtcaggggcgacgcctactcggtcgcc
gatccctacctcttcaccatcgccggctggctcgagtcggacggtgtcgatccggcccgg
tttccgcgaatcctcgaccatcgcaacaggatggccgagcgtccggccgtcgccaaggtt
ctggctgaagtgcagtcgtag

DBGET integrated database retrieval system