KEGG   Sinorhizobium meliloti 1021: SMc01311Help
Entry
SMc01311          CDS       T00058                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sme03012]
    SMc01311 (tuf)
   03029 Mitochondrial biogenesis [BR:sme03029]
    SMc01311 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sme04147]
    SMc01311 (tuf)
Translation factors [BR:sme03012]
 Eukaryotic Type
  Elongation factors
   SMc01311 (tuf)
 Prokaryotic Type
   SMc01311 (tuf)
Mitochondrial biogenesis [BR:sme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SMc01311 (tuf)
Exosome [BR:sme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SMc01311 (tuf)
  Exosomal proteins of breast cancer cells
   SMc01311 (tuf)
  Exosomal proteins of colorectal cancer cells
   SMc01311 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 1233006
NCBI-ProteinID: NP_385460
RhizoBase: SMc01311
UniProt: Q925Y6
LinkDB All DBs
Position
1477275..1478450
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQILCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgagcgcaataagccgcacgtcaacattggcacgattggccac
gttgaccatggcaagacgtcgctgacggcagcgatcacgaagtatttcggcgagttcaag
gcgtatgaccagatcgacgccgcgccggaagaaaaggcccgcggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccgaaccgtcactatgcgcatgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtttcggccgctgacggcccgatgccgcagacgcgcgaacacatcctgctggcccgccag
gtcggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggtcgacgacgcggaa
ctgctcgagctcgtcgagctggaagtgcgcgaactgctgtcgtcctacgaattcccgggc
gacgacattccgatcgtcaagggttcggctctggccgcgcttgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggtcgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggtacggtcgtgaccggtcgcgtcgagcgcggcatcgtcaaggtcggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgcttcgcggtgtcgac
cgcaacggcgtcgagcgcggtcagattctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggctgaagcctacatcctgacgaaggaagagggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgacg
cttccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgacgtcgagctg
atcgtgccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgcacc
gtcggcgcaggcatcgtcgcctccatcgtcgagtaa

DBGET integrated database retrieval system