KEGG   Sinorhizobium meliloti 1021: SMc02390Help
Entry
SMc02390          CDS       T00058                                 

Gene name
gst7
Definition
(RefSeq) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMc02390 (gst7)
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     SMc02390 (gst7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 1232689
NCBI-ProteinID: NP_385152
RhizoBase: SMc02390
UniProt: Q92R65
LinkDB All DBs
Position
1143380..1144081
Genome map
AA seq 233 aa AA seqDB search
MTAPIELYYWPTPNGWKITIMLEELGVPYVVKYINIGRGDQFQPDFLKISPNNRMPAIVD
PDGPGGESISVFESGAILQYLGRKYGKFYPSDERARVDVDQWLFWQVGGLGPMAGQAHHF
RQYAPERIAYGIDRYTNEVNRLYGVMNKRLADRPFLAGDYSIADMAAIGWVIPHENQGQD
LNEFPNLKRWFDAVLARPAVKKAIEVGKEERARQKSLAEDEEAQKVLFGQRAR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccgatcgagctttattattggcccacgccgaacggctggaagatcaccata
atgctggaggagctcggcgttccctacgtcgtcaagtacataaatatcggccggggcgat
cagttccagccggacttcctgaagatctcgccgaacaaccggatgccggcgatcgtcgat
ccggacggtccgggtggcgagtccatctccgtattcgaatcaggagcgatcctgcagtat
ctcggccgcaaatacggcaagttctatccgtccgacgagcgcgcccgtgtcgacgtcgat
caatggctcttctggcaggtgggcggactggggccgatggcggggcaggcacaccacttc
cgccaatatgccccggaaaggatcgcctacggcatcgaccgctataccaatgaagtgaac
cgcctctacggcgtgatgaacaagaggctcgccgaccgaccgttcctcgctggcgattac
tcgatcgcagacatggccgcgatcggctgggtgattccgcacgagaatcagggccaggac
ctcaacgaattcccgaatctgaagcgctggttcgacgccgtgcttgcgcgaccggcggtg
aagaaggccatcgaggtgggcaaggaggagcgggcccgccagaagagcctcgccgaggac
gaagaggcgcagaaggttctgttcggccaacgcgcccgctga

DBGET integrated database retrieval system