KEGG   Sinorhizobium meliloti 1021: SMc02520Help
Entry
SMc02520          CDS       T00058                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00564  Glycerophospholipid metabolism
sme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMc02520 (glpD)
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SMc02520 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 K_oxygenase GIDA 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 1234699
NCBI-ProteinID: NP_387121
RhizoBase: SMc02520
UniProt: Q92LM5
LinkDB All DBs
Position
3271269..3272780
Genome map
AA seq 503 aa AA seqDB search
MSEQTIFDVFVIGGGINGCGIARDAAGRGYSVALAEMSDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPFHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATKTLDMTRDPAGAPLKGLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARREGGRWAIEIESTETGARETMRARMLVNAAGPWVDRVLSEAVGNNDVRNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYQDEFTLIGTTDRDFTGNPADVRISDAEIDYLC
RAASEYFSDPVGREDIVWTYSAVRPLFDDGASKAQEATRDYVLRVENGDAPLLNVFGGKL
TTYRRLAESALEKIGETIGEKGRKWTAVSHLPGGDFPAAGYDDEVAKLRTRYPFLTASHA
RRLVRLYGTRAAQLLGNAASEADLGKHFGADLYAAEVDWLIVQEWALRAEDVLWRRTKLG
LKFSRAQTAELEEYMRGAVNAAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcagacgatcttcgacgtcttcgtcataggcggcggcatcaacggatgcggc
atcgcgcgtgatgcggctggccgcggatattccgtcgcgctggcggagatgagcgatttc
gcctccggaacatcctccggctcgaccaagctcatccatggcggcttgcgctatctcgaa
cattatgaattccgcctcgtgcgcgaagccctgatggagcgcgaagtcctctgggcgatg
gcgccgcacgtgatctggccgatgcgcttcgtgctgcccttccacaagggtggtccgcgg
ccggcatggctgatccgcctcggcctcttcctttacgatcatataggcggccgtaagctt
ctgccggcgacgaagacgctcgacatgacgcgcgatcccgcgggcgcaccgctgaagggc
ctcttcaccaaagcattcgaatattcggacggctgggtcgacgatgctcgcctcgtggtg
ctgaacgcgcgcgacgccgccgaccgcggcgcgaggatcatggcacgcacccgcgtcgtc
tcggcgcgccgcgagggcggccgttgggcaatcgaaatcgagagcacggagacgggcgcg
cgcgagacgatgcgcgcccgcatgctcgtcaatgccgcgggcccctgggtggaccgggtt
ctctccgaagcggtcggcaacaacgacgtccgcaatgtccgcctggtccagggcagccat
atcgtcgtgaagaagaagttcgacgatccgcgcgcctatttcttccagaacccggacggg
cggatcatgttcgccattccttaccaggacgagttcacgctgatcggaaccaccgatcgc
gatttcaccggcaatccggctgacgtgcgcatcagcgatgcggagatagattatctctgc
agggcggcgagcgaatatttcagcgacccggtcggcagagaggatatcgtgtggacctat
tccgccgtgcgcccccttttcgatgacggtgcgagcaaggcgcaggaggcgacccgcgac
tatgtgctgcgcgtcgagaacggcgatgcaccgctgctcaacgtcttcggcggcaagctc
accacctacaggcggcttgcggaatcggcgctcgagaagatcggcgagaccatcggggaa
aagggcaggaaatggacggccgtatcgcatctgccgggcggcgattttccggccgccggc
tatgacgacgaggtcgcgaagctcaggacgcgctatcctttcctgaccgcttcccacgcc
cgccggctggtacggctctacggcacgcgggcggcgcagcttctcggcaatgccgcgagc
gaggccgacctcggaaagcacttcggcgcggatctctatgctgcggaagtggattggctc
atcgtgcaggaatgggcattgcgcgcggaggacgtgctttggcgccgcacgaaactggga
ctgaagttttcgcgggcgcaaaccgcggaactggaggaatatatgcggggcgcggtcaac
gcggccgcctga

DBGET integrated database retrieval system