KEGG   Sinorhizobium meliloti 1021: SMc03959Help
Entry
SMc03959          CDS       T00058                                 

Definition
(RefSeq) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sme00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SMc03959
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sme03400]
    SMc03959
Enzymes [BR:sme01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SMc03959
DNA repair and recombination proteins [BR:sme03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SMc03959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 1234419
NCBI-ProteinID: NP_386849
RhizoBase: SMc03959
UniProt: Q92M95
LinkDB All DBs
Position
2951627..2954224
Genome map
AA seq 865 aa AA seqDB search
MAARNEPLSEYNRRRDFTRTSEPKGAVARRSGDNRMRFLVQKHAATRLHYDFRLEWEGVL
KSWAVTRGPSLNPEDKRLAVRTEDHPLAYGDFEGTIPKGEYGGGTVMLWDTGWWEPEDDP
SKALKKGKLSFKLHGSRMKGGWALVRMRPREGEKRENWLLVKETDDVASDDGESLINENI
TSIVTGRTMEEIAEGRGEKRARVWHSNKSISANLKAGAIAENGNAGKRATRKASGKLPAF
KAPQLATLVTKVPAGDAWLNEAKFDGYRLVCAVGAGTVRCYTRNGLDWTEKFPAIAAALA
ELDCQSALIDGEVVALSEGGSTFSALQKALRTGASTRLYAFDLIELDGKDLSRKPLVERK
ERLEALLQTLGATSTVQFSEHVRGNGEHVLSAICKAGQEGIIAKEADAPYRSGRSRSWLK
VKCTKRQEFVIGGYTPSSKKGRAFASLLVGTFEGGKLIYRGGVGTGFSGKTMEDLAAAFA
KRKRDTSPFDSVPRERMRNSVWLEPDLVAEVDFAEFTADGHVRHGSFEGLREDKEARAVK
LETPKPAEAEPETAKSKSSARTRKTPPVQGDADVLGIRISHPDRVLFEGQGITKIDLARY
YAVVAERMLPFAADHPVSLVRCPQGGERHCFFQKHASDGFPEAIREVPITESSGDTENYM
YIHDAKGLVAAVQMGTLEFHIWGSSIDRLEKPDRLVFDLDPDPSVDFETVKAAALRLRDE
LAEIGLKTVPMVTGGKGVHVIVPLRPHAEWEEAKGFAKALARSIAERDPDNFVATMSKAK
RKGKIFIDWLRNDRGATAIAPYSTRARSGGPVATPVGWDELQGLEAANGFQIPDIIERIE
AGTDPWREIGKISQSLTKKILNSVE
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcgcaatgaaccgctttccgaatataaccggcgccgcgatttcacgcggacg
agcgaacccaagggagcggtcgctcggcgcagcggggacaacaggatgcggttcctggtt
cagaagcacgctgcgacccgcctgcattacgacttccgcctggaatgggagggcgtgctg
aagagctgggcggtcacacgcggcccgagcctcaaccccgaagacaagcgcctggccgtg
cgtaccgaagaccacccgcttgcctatggcgacttcgaaggaacgataccgaagggagag
tatggcggcggtaccgtgatgctctgggataccggctggtgggagccggaggatgacccg
tcgaaagccctgaagaagggcaagctctccttcaagctgcatggcagccgaatgaagggc
ggctgggcgctggtgcgcatgcggccacgcgaaggcgaaaagcgcgagaactggctgctc
gtcaaggaaacggacgatgtcgcctccgatgacggcgagagcctgatcaacgagaacatc
accagcatcgttaccggccggacgatggaggagatcgccgaaggcaggggcgagaagcgg
gcgcgggtctggcattccaacaaaagcatctcggccaatctcaaggccggcgcgatcgcc
gaaaacggcaatgcaggcaagcgcgcgacgcgaaaagcctccggcaagctgcccgccttc
aaggcaccgcagctggcgactctggtgaccaaggtgcccgccggcgacgcatggctgaac
gaagccaagttcgacggctaccgtcttgtctgcgccgtcggtgccggcaccgtgcgctgc
tacacgcgcaacggcctcgactggaccgagaagttcccggcaattgccgccgcccttgcc
gaactcgactgccagtccgctctgatcgatggcgaagtggtggcgctttcggaaggcgga
tcgaccttctcggccctgcagaaggcgcttagaacgggggccagcacacggctttacgct
ttcgatctcatcgagctcgacggcaaggatctgagccggaagccgctcgtggaacgcaag
gaacggctcgaagcgctgctccaaacgctcggcgccacctctaccgtacaattcagcgag
catgtccgcggcaatggcgagcacgtgctttccgcgatatgcaaggccggccaggagggt
ataatcgccaaggaggccgatgccccctatcgcagcgggcgcagccgaagctggctcaag
gtgaaatgcacgaagcgccaggagttcgtgatcggtggctataccccgtcttcaaagaag
gggcgtgccttcgcctcgctgctcgtcgggaccttcgaaggcgggaagctgatctaccgt
ggcggcgtcggcaccggtttcagcggaaagacaatggaggacctcgccgcggccttcgca
aagcgcaagcgcgatacgtcgcccttcgacagcgtgccgcgagagagaatgcgaaattcg
gtatggcttgagccggacctggtggcggaggtggatttcgccgaattcacggccgacgga
catgtccgtcacggttcattcgagggattgcgcgaggacaaggaggccagggccgtgaaa
ctggagacaccgaagccggcagaagcggagccggagaccgccaagagcaaatcttccgcc
aggacgcgcaagacgccgcctgtgcagggagacgccgatgtcctcggcatccgcatctcc
catccggaccgggtgctcttcgaaggccagggcatcaccaagatcgatctcgcccgctat
tacgccgttgtcgccgagaggatgctcccctttgccgccgatcaccccgtttcgctggtg
cgctgcccgcagggcggcgagcggcactgtttcttccagaaacacgcaagcgacggcttt
cccgaggcgatccgggaagtgccgattaccgagtcatcgggcgacaccgagaactatatg
tacatccacgatgccaagggcctcgtcgccgccgtgcagatggggacgctcgagtttcac
atctggggttcaagcatcgaccggctggagaaacccgaccgtctggtcttcgatctcgac
cccgatccgagcgtcgacttcgagacagtcaaggcggcagccctcaggctccgcgacgaa
ctcgccgagatcggcctgaaaacagtgcccatggtgaccggcggcaagggcgtccacgtc
atcgttccgctccgcccccatgccgaatgggaggaggccaaaggcttcgcgaaagcgctc
gcgcgatctatcgccgagcgcgatccggacaatttcgtcgccaccatgtcgaaggcgaag
cgcaagggaaagattttcatagactggctgagaaacgatcgcggcgccacggcgatcgcg
ccctattccacccgcgcgcgctccggcggaccggtcgccacaccggtcggctgggacgaa
ctccaaggcctcgaagccgccaacgggtttcagattccggacattatcgagcggatcgaa
gccgggaccgatccgtggcgggagatcggcaagatcagtcagtcgctgacgaagaagata
ttgaactcggtcgaatga

DBGET integrated database retrieval system